Welcome to Dubai Yellow Pages Online
Global Site for local Search
Get it on Google Play
Elite Products in Luggage, Bags & Cases Market of Dubai

Fire Resistant Cables Supplier in UAE

Fire Resistant Cables supplier in UAETypical Applications:BMS / Access Control / InstrumentationMobile: 00971 56 1720220Email: dhaneesh@ontides.com
Supplier : OnTides International FZC Umm Al Quwain
Posted On :2 days ago

Medical wheel chair Scale suppliers in uae

Medical Scales or wheel chair scales @ City Scales Fzc
Supplier : City Scales Fzc AJMAN
Posted On :4 days ago

Caps & Headwear in abu dhabi

Get Ahead with this selection of great head wear!
Supplier : Chinese Gift Trading DUBAI
Posted On :5 days ago

Construction Machinery

Gasoline generators, Diesel generators,lights tower,concrete cutter,road roller,compactor,concrete mixer,power trower,water pump,Pavement Rammer
Posted On :5 days ago

Cuplock System Suppliers in UAE

We are the leading engineering industry with our excellent gamut of Cuplock Scaffolding System & Accessories. This type of lock system is quite versatile to use and can be seen in construction, demolition or maintenance projects. Cuplock system allows quick fastening of horizontals scaffolding & is very reliable and safe. With the use of our impeccable Cup-lock system, four horizontals can easily be fastened at one time with firm clamping action of top cup thereby making the joint rigid. We have appointed some of the highly skilled personnel who have engineered these cup-lock systems in such a manner that it ensures quick erection and dismantling thus reducing on time and labor work.With us, we have a wide selection of Cup-Lock Systems that includes:Vertical Cuplock SystemStandard Cuplock SystemLedger Cuplock SystemHorizontal Cuplock SystemTransomInside Board Transom
Posted On :2 weeks ago

Elevator Bucket Bolts

Elevator Bolts are large flat head bolt fasteners designed to hold together canvas belts in conveyer systems. Elevator bolts comes in fanged head, ribbed neck and slotted head styles. Elevator bolts are often referred as bucket bolts or elevator bucket bolts. Bucket bolts are often used with hex nuts or nylock nut, along with washer set. Elevator bolts dimensions are defined in both metric and imperials sizes with unified national coarse pitch (UNC), fine pitch (UNF), fixed pitch (UN) and iso metric thread profile. These are produced across all material categories and astm specifications.Browse the page for information on elevator bolt manufacturing process, forming method, available sizes, sub-types, thread types, metric and imperial dimension standards, weight charts, torque values, material categories, grades and astm specifications.
Posted On :2 weeks ago

Wheel Chairs

Wheel Chairs
Posted On :2 weeks ago

Industrial Hose Suppliers in Dubai

Gates industrial hose products are engineered for high performance and cost savings. Select from the categories below to find the right hose, couplings, and equipment for your application. Or find a Gates industrial fluid power distributor near you.
Supplier : Gates Engineering and Services ABU DHABI
Posted On :2 weeks ago

CARGO PANTS suppliers in Abu dhabi

CARGO PANTS in abu dhabi
Supplier : Salima Garments & Tailoring Company LLC ABU DHABI
Posted On :2 weeks ago

Check Scanner in Ethiopia

Single-feed to high-speed, our Check scanners are most reliable with best image and MICR reading rates. The scanners are easy to install and require minimal maintenance with high ROI. These give the highest throughput of any desktop with the ability to feed wider range of documents.Applications:Teller CaptureBranch CaptureRemote Deposit Capture
Posted On :2 weeks ago

Stainless Steel Shim Washer

We offer a comprehensive range of premium quality Stainless Steel Shim Washer. We used only the international certified raw materials and the most advanced technologies to manufacture these products. These steel washers are completely stain resistant, corrosion resistant, chemical resistant, durable and highly efficient In addition, they are available in affordable prices.Price may vary depending on product.Features:Excellent finishingEasy to installDurable
Supplier : Pearl Overseas MUMBAI
Posted On :3 weeks ago

Toyota Landcruiser Hard Top VDJ 78L Ambulance

Toyota Land Cruiser Hard Top VDJ78L-RJMRYV-1D-HD2 Ambulance
Supplier : Dazzle Auto Trading AJMAN
Posted On :3 weeks ago

Pressure Vessels Heat trace cable supply and installations

Electrical HEAT TRACING,HEATING System for pressure vessels. Installation of Electrical Heating system for Pipe Lines,Skid,Gas Storage tank,pressure vessels. Oil and Gas Electrical Heating system installation and Maintenance. Constant wattage Heating cable installation,Self Regulate Heating cable installation and Termination. Electrical Panel Installation and Maintenance, info@paklinkllc.com 0097145548493 00971504245839 Electrical- Instrument-Heat Trace.
Supplier : PakLink Services LLC DUBAI
Posted On :3 weeks ago

Food Chemicals

Sr. No.ProductsApplications1.Butylated Hydroxy toluene(2,6 DBPC)Antioxidant for food products, industrial fats, Oils and fatty acids, also used in feed & forage products as antioxidant.2.Tertiary butyl hydroquinone(TBHQ)Excellent antioxidants for vegetable oils, edible animal fats, essential oils, nuts, foods and food packaging materials.3.Butylated Hydroxy Anisole(BHA)Antioxidant for variety of food products like edible oils, fats, meat products, spices, snack foods etc.4.Propyl GallateAntioxidant to stabilize cosmetics, food packaging materials, and foods containing fats. As an additive, it may be found in edible fats, oils, mayonnaise, shortening, baked goods, candy, dried meat, fresh pork sausage, and dried milk, and it is used in hair grooming products, pressure-sensitive adhesives, lubricating oil additives, and transforming oils.5.Sodium CaseinateUsed for Meat Tendering6.Citrus PectinMost versatile gelling, thickening and stabilizers used in Fruit Processing, Jams, Jellies, desserts, Bakery Fillings, Toppings, Fruit preparations for dairy, Dairy Applications such as Acidified milk and protein drinks, Yoghurts (thickening) , Confectionary-Fruit Jellies, Beverages- Permanent cloud stabilizer7.Potassium Sorbate FCC IVPreservative (food grade)8.Sorbic Acid FCC IVPreservative (food grade)9.Benzoic AcidPreservative (food grade and medicinal grade), Anti- microorganism medicinal preparation , Plastic plasticizer and organic synthesis raw material.10.Beta Carotene 1% SD (Spray Dried Powder)Coloration of beverages, instant products puddings, confectionary, bakery, sorbet, milk products and other water based products. Beta carotene 10% DGColoration of beverages, instant products, puddings, confectionary, bakery, dairy products and other water based foods. Beta carotene 22% UFSUsed for colorization of popcorn oil and other oil based foods where heat stability is required. Dietary supplements including liquid oral dosage and soft gelatin capsules. Beta carotene 30% UFSUsed for coloring oils, fats and oil based foods including margarine, cheese, ice cream, soups, bakery products, mayonnaise, salad dressing and sauces. Additional uses include beverages, soft drinks and snacks. Natural Beta-carotene with mixed carotenoids (from Dunaliella salina) 1% , 2.5% and 7.5%Used for oil enrichment11.Asta Feed 10%Ideal for fortification of extruded feed, producing consistent pigmentation in aquaculture applications.12.Citric Acid Anhydrous BP98/Citric Acid MonohydratePreservatives, synergist for antioxidants, flavoring agents.13.Textured Soy Protein concentrate/isolate/TVPUsed for Meat processing14.Soya LecithinBakery products15.FlavorsNatural Flavors for dairy products, juices etc.
Supplier : Aastrid Middle East SHARJAH
Posted On :4 weeks ago


Everest brand Electric blowers in 220V from 8" to 20" Dia For inquiries contact : sales@murtuzatrading.com or call : 050-6325514 
Posted On :2 months ago

Car Park Shades, Parking Shades, Car Park Shed, Shades, Tensile Shades

We are The Manufacturers Suppliers Installation Repairs Maintenance of  Parking Shades, Wedding Tents Rental, Furniture Rental, Awnings, Canopies, Sail Shades, School Shades, Tensile Shades, wooden pergola, Cane Outdoor Furnitures, Cane Indoor Furnitures, Cane Garden Furnitures, kitchen Cabinets, Aluminium Doors Windows, Gates And Fence, Renovation Repairs Maintenance Villa, Residential Commercial Buildings in Dubai Sharjah Ajman Umm Al Quwain Ras Al Khaimah Fujairah Abu Dhabi Alain UAE. More details Contact 0505773027 / 0568181007Thanks & Regards.Mob. 0568181007 / 0505773027www.alduhatents.blogspot.aewww.parkingshades.weebly.comAwnings Canopies Manufacturer in Dubai Sharjah Ajman Umm Al Quwain Ras Al Khaimah Fujairah Abu Dhabi Alain UAEAwnings are primarily designed for sun protection and not wind and rain protection. Whilst the high quality farbrics are very much resistant to rain, they are by no means waterproof. If you require shades for wind and rain, then we would advise that you consider parasols over awnings. We are Suppliers all commercial and Residencial purpose.Supermarkets, Hotels, Shopping Malls, Centers, Industrial Companies, Coffee Shops, Resturents, and more commercial use.OnlyAL DUHA TENTS +971568181007   is the world brand in awnings and for more than a quarter of a century now has been making sure that life on the balcony and the patio is made even more exclusive than ever.Simply the best.AL DUHA TENTS +971568181007  brings technical understanding of design engineering and a highly developed knowledge of textiles. Markilux design and produce every part of the highly durable, light and creative frameworks and mechanisms in house. Each model employs proven technology from many years of research and development, protecting your investment in this fine range of awnings. Widths of up to 7 metres for a single awning is possible.FabricsThe choice of fabric types and colours is truly peerless. From solid acrylics through to blocked stripes of all patterns, there will be something that appeals to each and every client. All fabrics are made in the factory. Our standard prices offer Sunacryl fabric.For over 8 + years Al Bait Al Duha Tents has been providing service and benefits to our loyal dealer network that is unmatched in UAE.  Al Duha Tents has direct access to the research, development, and innovation of one of the UAE largest awning manufacturers, Supplier, Exporters, in the Gulf Countries, African Countries. And other part of the world.The strongest distribution network in the industry provides consumers with the perfect shading solution for those difficult application that other dealers must walk away from.  In addition to exclusivity of products, Al Duha Tents has the most expansive line-up of interior and exterior shading products. Al Duha Tents also has comprehensive marketing programs geared towards supporting our dealer network and driving business to our business partners. The Commercial awning office was founded in 2002 by a local business successfully grew and expanded the company.  In 2004, Commercial Awning Division, handling the manufacturing and installation for retail and restaurant groups, developers, and general contractors located throughout the GCC and over the world.AL DUHA TENTS +971505773027 founded in 2004  Our manufacturing and corporate headquarters are located in SHARJAH INDUSTRIAL AREA. AL DUHA TENTS . Suppliers world-class motorized patio awnings and motorized window awnings that add lasting value to homes and businesses.ClienteleOur prestigious clients include: World Trade Center ( WTC ) Dubai, British Counsil Dubai, Freeman Contracting LLC JAFZA Dubai, Beach Hotal Jumeriah Dubai, Faramount Hotel Dubai, Nissan Service Center Fujeriah, Arabian Automobiles UAE, Emirates Glass LLC Dubai, Dubai & Partners Groups Dubai, Souq Extra Dubai, Tesco JAFZA Dubai, Sharp Middle East  JAFZA Dubai, Ras Al Khaimah Airport RAK, EMAAR Groups Dubai, Dubai College Dubai, Chenni Tecnical Services Sharjah, Sun Shadow contracting Sharjah, Prograsive School Sharjah, Hamriya FZE Sharjah, SAIF Zone Sharjah,THANKS & REGARDSAL DUHA TENTS 0568181007 / 0505773027
Supplier : Car Park Shades ( Al Duha Tents 0568181007 ) SHARJAH
Posted On :2 months ago


HI TECH PACK & TRANS We Hi-Tech Pack & Trans LLC, as a well-established in 2007 of packing solutions & material provider dealing with many major leading companies in UAE.  In this regards, we do have a perfect team of specialists to fulfill all your orders with in the specified time frame & We having a good Team to do your packing very safely and transporting to your final destination. We offer you the world class quality products and give very attractive price/quote which you have been never enjoyed from any other company.
Posted On :2 months ago

Self Locking Nut

We are counted among the reputed business entities, engaged in offering the best quality range of Self Locking Nut.Features:Easy and Convenient to useSturdinessHigh strengthAvailability: Also available in SS, MS etc.
Posted On :2 months ago

HP M402DN Printer

Fastest first page outThis printer wakes up and prints faster than the competitionFast two-sided printingBreeze through multipage documents with two-sided printing that's faster than the competition.30% more pagesGet more pages than ever before, using Original HP High-Yield Color Toner cartridges with JetIntelligence.Helps save energy and easily manage tasksPrint using less energy than competitors—enhanced by Original HP Toner cartridges with JetIntelligence.Easy mobile printingPrint straight from your smartphone or tablet in just a few simple steps.
Supplier : Value Point Trading LLC DUBAI
Posted On :2 months ago

polypropylene sack in uae

We are the wholesale distributors and exporter of of FIBC / Big Bags / Jumbo Bags / PP BAGS/ CEMENT BAGS  etc that are available in various sizes and different specificationsfor more information please contact us;Email: basheer@makkaplastic.comMobile : 00971565501004Web: www.makkaplastic.com
Supplier : Anwar Makkah General Trading L.L.C ( MAKKA PLASTICS ) AJMAN
Posted On :2 months ago

Office Supplies

Buy online wholesale furniture office supplies of desk chairs Crosswords online shop for wholesale furniture warehouse, double deck bed. office supplies, desk table with semi executive chairs. Buy modern furniture Address: 102/17, Spectrum Building, Oud Metha,P.O. Box # 191987 DUBAI – UAE. Phone:+971-4-313-8815 Email: sales@crosswords.ae Website: www.crosswords.ae
Posted On :2 months ago

Tectile paver supplier in UAE

Thomas Mathew.PGeneral Manager,PO Box:150272,Sharjah-UAE.Mob:+971 50 6778440Mob:+971 55 999433Sales & Marketing OfficePO Box:125411,Dubai-UAE.Tel No:+971 4 4541102Fax No:+971 4 4541103
Supplier : Alcon Concrete Products Factory LLC DUBAI
Posted On :2 months ago

Carolyn Gel Eyeliner Distributor UAE

Dark brown and Light Brown shades are available also.. 
Posted On :2 months ago

Zoll AED

As the sole authorized Distributor for Zoll in the UAE. We offer the complete range of Zoll AEDs and Defibrillators.Models include:Zoll AED PlusZoll AED ProZoll AED 3Zoll AED 3 BLSReplacement Warranty offered for all models.Comprehensive after sales service is provided with dedicated engineers based in Dubai and Abu Dhabi covering the whole UAE.Free product training is also provided to every customer.
Supplier : Leader Healthcare FZCo DUBAI
Posted On :3 months ago

Blasting coverall Supplier In Qatar, Jordan, Bahrain, Cyprus, Saudi Arabia, Egypt

Expert Traders // expertvinayak7@ gmail.com // +971-56 6385844 // +971-56 6181714 Blasting Suit 100%  Cotton
Supplier : Expert Traders FZC AJMAN
Posted On :3 months ago


Posted On :3 months ago

Air Bubble

Bubble wrap is a pliable transparent plastic material used for packing fragile items. Regularly spaced, protruding air-filled hemispheres (bubbles) provide cushioning for fragile items. The bubbles that provide the cushioning for fragile or sensitive objects are generally available in different sizes, depending on the size of the object being packed, as well as the level of cushioning protection that is needed. Multiple layers might be needed to provide shock and vibration isolation. A single layer might be used just as a surface protective layer. Bubble wrap is used to form some types of mailing envelopes. Bubble wrap is most often formed from polyethylene (LDPE) film with a shaped side bonded to a flat side to form air bubbles. Some types of bubble wrap have a lower permeation barrier film to allow longer useful life and resistance to loss of air in vacuums.
Supplier : BlueCart Packaging LLC DUBAI
Posted On :4 months ago

motorcycle helmets

motorcycle helmets
Posted On :4 months ago

Concrete Ramp

White Metal Contracting LLC has always endeavoured to innovative and supports its clients to perform better, by meeting their demand for quality, service, competitiveness and timely completion of specified scope of work. Continuously achieve and improve the effectiveness of the works and systematic developments in the organization.www.whitemetalco.comsales@whitemetalco.com
Supplier : White Metal Contracting LLC AJMAN
Posted On :4 months ago


Posted On :4 months ago

Multi Color Pouch

By keeping in mind variegated demands of our respected clients spread all over the country, we are manufacturing and supplying an exclusive range of Multi Color Pouch. The pouch offered by us is designed by our experts using top notch quality basic material and modern technology in compliance with the latest market standards. Our offered range provides a definite marketing advantage over traditional packaging. We offered this pouch to our valuable clients at rock bottom prices. Features: Durable printingMoisture resistanceFine finish
Supplier : White Lotus Industries Limited SURAT
Posted On :4 months ago

Counter Shaft Sprocket

Premium grade of Counter Shaft Sprockets offered by us are ideal for various industrial applications. We make use of superior quality material and advanced technologies to make these sprockets excellent in quality and durability. Further, these are offered by us in various sizes and designs to suit the requirements of different clients
Supplier : B. V. Transmission Industries MUMBAI
Posted On :5 months ago

Special Grade Pipes

We have a wide range of pipes that are made up of monel, nickel, inconel, hastalloy, copper, brass, bronze, titanium, tantalum, bismuth, aluminum, high speed steel, zinc, lead, etc. These pipes are available in round, square and rectangular shapes. Size: Upto 24” NB. (Seamless & Welded)Wall Thickness: Sch. 5S to Sch. XXS.
Supplier : Steel fab India MUMBAI
Posted On :5 months ago


Submersible Motor is manufactured in ISO 9001 design with NEMA Standard. Submersible motor is available in Cast Iron, SS 304 & SS 316 construction. Submersible motors are built using advanced technology and components of superior quality that they ensure good mechanical strength and excellent electrical reliability. Submersible Motors are available in 50 as well as 60 Hz. Premium motors are the choice for dependable, maintenance-free operation and provide a long life for your submersible pump operation. Lubi Offers Submersible motor from 3” to 4” oil filled and from 3” to 10” water filled up to 250 HP
Posted On :5 months ago

Metal Scrap in UAE

We immediately buy all  kinds of metal scrap 0564113933 056-6653908
Supplier : Al Rukn Metals SHARJAH
Posted On :5 months ago

Flex Impact - Safety Barriers Flex Impact - Safety Barriers

We are reputed exporters and suppliers of highly qualitative Safety Barriers. These barriers are highly acclaimed for their resistance to impact from vehicles. These are used extensively in industries for the purpose of marking areas which are safe and areas which are unsafe. These barriers are installed at the periphery of areas which are unsafe in order to prevent workers and employees from entering those premises. These are installed in order to prevent accidents and mishaps, which happen frequently in industries. These are also used to mark no-entry zones. We supply these to clients in different shapes and sizes.1- FLEX IMPACT is a customized industrial barrier used to protect equipment and people at the workplace. The product range within this category includes Handrails, Traffic Barriers, Bollards and Goal Posts, Rack Protectors, Column and Corner Protectors and Safety gates and Floor Marking. Our Polymer guard rail absorbs impact and returns to their original shape after impact without damage to itself or the floor. Due to the nature of the material used the product alleviates paint jobs, replacements and concrete repairs providing strength and esthetics over time.Boplan has been tested to withstand impacts of 6000 lbs forklift moving at 11 mph.Features:Damage-resistant designDurableAffordable
Supplier : Amfico Agencies Pvt. Ltd. DUBAI
Posted On :5 months ago

Rota Meters in UAE

Rota Meters in UAE
Supplier : Solutronix Industrial Instrument, Electrical and Automation LLC AJMAN
Posted On :5 months ago

Outdoor Sports Flooring Specialist in Dubai, UAE

CONTACT Mr. SHA # +971 5555 6 4004                E-MAIL : info@zayaanco.com              www.zayaanco.com                                                              We Zayaanco is a leading supplier and distributor of a wide range of flooring materials in Dubai, Abu Dhabi, Sharjah and all across UAE and GCC. Our Company is established in 1997 with the goal of supplying quality and branded products in lowest possible prices. Our products include wide variety of Wooden Flooring, Vinyl Flooring, WPC Decking, Raised Access Flooring, Rubber Flooring, Gym Flooring, Sports Flooring, Carpet Flooring, EPDM Flooring, Interlock Paving Tiles, Ceramic Tiles etc.We are specialized in supplying and installing premium floor coverings in competitive prices. We always ensure to maintain a good customer relationship by constantly reviewing our customer's feedback and also we take care ofour after sales services. Our aim is 100% customer satisfaction and thereby building and maintaining our position as a quality supplier of flooring materials for residential and commercial clients all over UAE and GCC. We are always devoted to expand our range of products to provide original and fresh designs in the market.Flooring plays an important role in office and home decor. There are a wide range of flooring types and when you think about flooring Zayaanco is the best solution for all your needs whether it is Commercial, Residential or Industrial. You can find wide variety of flooring products in Zayaanco. We provide stylish, durable and premium flooring products to your door step. You can browse through our wide range of products and get the best and quality products at affordable prices. We provide almost all brands of flooring products from Europe, Canada, USA and Asia.One Stop Shop for flooring & Acoustic Solutions:PRODUCTS:Flooring Solutions: 1. Hardwood Floor2. Solid Wood     (Sports flooring, Cottage flooring, Domestic floor, Hands scraped           floors, Hollow decking, Solid decking, Hardwood decking, DIY     Tiles)3. Laminated Wood4. Engineered / Semi Solid Wood5. External Wood & WPC Decking    (Decking, Wall paneling, Fence, Pergola, Railing) 6. Rubber Floors    (Commercial and recreational flooring, Sports flooring, Equine          flooring, Play ground flooring, Safety rubber tiles and pavers,         industrial rubber flooring, Ballstic rubber products) 7. Gym / Fitness Floors8  Carpets    (AX - Minister, Hand tufted, Carpet tile, Machine tufted, Mosque        Carpet, Rugs)  9. Vinyl Floors     (Homogeneous Vinyl , Heterogeneous Vinyl , Luxury Vinyl tiles ) 10. Raised Access Floors    (Steel cementatious panel, wood core access floor, Calcium sulphate     access floor, Air flow systems) 11. Sports Floors12. EPDM / SBR Floors13. Interlock Floors14. Wall cladding Bricks15. Adhesives, Self levelling compounds, Rubber Wheel Stoppers, Corner guards Etc....ACOUSTIC SOLUTIONS1. Accoustic Panel2. Accoustic Fabric3. Accoustic Walls & CeilingWe have high quality flooring with European and American Specification and certificates. Also registered approved by PWD and other government departments and have done lot of projects over worldwide.PROPERTIES:Heavy Duty, Fully Flexible, No Wax No Polish for life, Anti Bacterial, Anti Fungal, Antistatic, RQ Protect, Slip Resistance, Fire ResistanceAPPLICATIONS:1. SPORTS/GYM FLOORING             12. OFFICE/SUPERMARKET FLOORING  2.CONDUCTIVE FLOORING              13.CONTRACT FLOORING3.HOSPITAL FLOORING                    14.LABOUR CAMPUS FLOORING4.SAFETY FLOORING                       15.ACOUSTIC MULTILAYER FLOORING5.PORTA CABIN FLOORING              16.LINOLEUM VINYL PRINTED FLOORING6.UNIVERSITY FLOORING                17. BUS FLOORING7.COMMERCIAL FLOORING             18.LAMINATED FLOORING8.SCHOOL FLOORING                     19. PVC SKIRTINGS9.DOMESTIC FLOORING                  20.ANTISTATIC FLOORING10.COMPACT VINYL FLOORING      21.HETROGENEOUS FLOORING11. HOMOGENEOUS FLOORING     22.JOGGING TRACK Available in rolls- 2 meter wide and tiles-30*30cm,45*45cm,50*50cm,60*60cm.Our prices are competitivee. We give fast deliveries  in house installation and we have good and expert team for  installation and we have done in millions.We, ZAYAANCO are trader, manufacturer & installer of Safety & Aesthetic Rubber Flooring. PRODUCTS:1. Safety & Aesthetic Rubber Tiles. 50 x 50 cm, up to thickness of 4.5 cm.2. Safety & Aesthetic Seamless Wet Pour Rubber Flooring. Different thicknesses and colors available3. Rubber Mulch for safety and aesthetic landscaping applications. Comes in form of rubber shreds, chips and buffing. APPLICATIONS:1. Safety Applications: Playgrounds, basketball & football fields, high voltage electrical insulation, heat insulation, chemical insulation, gyms, running tracks, walkways, all types of sports flooring and animal stables.Safety Features: Shock absorbing, slip resistance, chemical resistant, heat insulation and electrical insulation.2. Aesthetic Applications: Indoor & outdoor applications including court yards, backyards, coffee shops sitting areas, around swimming pool decks, walkways, corridors, car parks, garages, staircases, lobbies etc.Aesthetic Features: They look beautiful because of their elegant look, strong colors and unconventional styles, which gives an outstanding unorthodox looks to your indoors and outdoors. 3. SPECIAL FEATURES OF RUBBER MULCH:Rubber Mulch is as an excellent replacement of wooden mulch. Wood mulch can rot and becomes a breeding ground for insects and germs. It can destroy the plant entirely or shorten its life. The rubber mulch is much safer solution which comes in variety of designs (shreds, chips or buffing) and colors. It does not pose any problems as rotting, dampening, insect breeding etc. Furthermore it provides good water retention in soil, no bacteria or algae growth. As a result, it leads to longer and healthy botanical life.MATERIAL:Safety & Aesthetic Rubber Flooring is available in recycled EPDM or SBRrubber, as well as in virgin fast colored EPDM. All our products are made from non-hazardous and non-toxic material which is safe for use in all type of environments and all age groups of people.GUARANTEE:Our product guarantee is for 10 years.key words: Sports flooring, Hospital flooring, Clinics floor, Auditoriums flooring, Hallways, Reception flooring, Supermarket flooring, Waiting rooms flooring, Office room flooring, Kindergartens flooring, Laboratories flooring, Class rooms flooring, Dormitories flooring, Antibacterial and anti fungal flooring, Moduler structures flooring, Storage & Service areas flooring, Labs flooring, Mass merchant retail flooring, Industrial premises flooring, Accommodation flooring, Holiday homes flooring, Youth camp flooring, Hotels and hostels flooring, Porta cabin flooring, Retails centers flooring, modular structures flooring, Server rooms flooring, Electronic manufacturing flooring, Radiotherapy and lab areas flooring, Computer rooms flooring, Electronic manufacturing rooms, Radiotherapy and lab areas flooring, Shop flooring, Clean industries flooring, Intensive care rooms flooring, Transport buses flooring, coaches flooring, Trains flooring, Subways flooring, Boats flooring, airports flooring, train flooring, Ferry terminals flooring, Ramps flooring, Elevated corridor access flooring, Lifts areas flooring, Entrance area flooring, Corridor access flooring, Kitchen flooring, Wet ares flooring, Healthcare leisure flooring, Schools flooring, Industrial flooring, Heavy duty flooring, Heavy traffic areas flooring, Wet areas flooring, Shower flooring, Bathroom flooring, Food preparation areas flooring, Toilet flooring, Ramps flooring, Sloped corridor access flooring, Garage flooring, Work shop flooring, Delivery area flooring, Preparation area flooring, Construction site flooring, Site office flooring,Storage room flooring, Locker rooms flooring, Class rooms flooring, Hotels flooring, Old-age homes flooring, Residential community flooring, Play area flooring, Auditoriums flooring, Meeting rooms flooring, Bar flooring,Lounges flooring, Modular homes flooring, Structures flooring, Leisure centers flooring, Sports flooring, Retirement homes flooring, health institutions flooring, Fitness rooms flooring, Physiotherapy units flooring, School activity rooms flooring, Multi-purpose halls flooring, Volley ball courts flooring, Basket balls flooring, Table - tennis rooms flooring, Bars and coffee shops flooring, Boutiques and stores flooring, Quality vinyl flooring, European standard flooring, Heavy duty vinyl flooring, Sports flooring, Homogeneous flooring, Heterogeneous flooring, Conductive flooring, Anti static flooring, Hospital Flooring, Safety flooring, School flooring, University flooring, Acoustic flooring, PVC linoleum flooring, Compact vinyl flooring, Labor camp flooring, Porta cabin flooring, Rubber flooring, PVC parquet flooring, Contract flooring, Domestic flooring, Laminated flooring, Office flooring, Coin type rubber floor, Stud type vinyl floor,  Supermarket flooring, Carpet flooring, PVC Skirting, Cove, Cape, Resilient flooring, Raised access flooring, Waterproofing vinyl flooring, Anti slip flooring, Coin type vinyl flooring, Stud type vinyl flooring, Outdoor sports flooring, Indoor sports flooring, Sports flooring companies in dubai, Homogeneous flooring, Heterogeneous flooring in dubai, Conductive flooring in dubai, Antistatic flooring in dubai, Hospital flooring in dubai, Sports flooring in dubai, Safety flooring in dubai, Safety flooring dubai, School flooring in dubai, University flooring in dubai, Acoustic flooring in dubai, PVC Linoleum flooring in dubai, Compact vinyl flooring in dubai, Labour camp flooring in dubai, Porta cabin flooring dubai, Rubber flooring in dubai, PVC Parquet flooring in dubai, Contract flooring in dubai, Domestic flooring in dubai, Laminated flooring in dubai, Office flooring in dubai, Supermarket flooring in dubai, Carpet flooring in dubai, Resilient flooring in dubai, Raised access flooring in dubai, water prrofing vinyl in dubai,  keywords: epoxy flooring dubai, epoxy flooring uae, epoxy coating specialist, specialist epoxy contractor, epoxy professionals in dubai, epoxy flooring dubai, epoxy flooring sharjah, epoxy concrete paint, epoxy contractors, floor coating, floor coatings, floor coating contractors, floor coating contractors in dubai, floor coating contractors in sharjah, metal roof coating contractors, metal roof coating contractor in sharjah, roofing contractors, roofing coating, roof coatings, roof epoxy applicator, metal roofing applicator, decorative chip epoxy floor coating, concrete floor epoxy, maydos epoxy base floor, maydos epoxy contractor, maydos epoxy applicator, maydos epoxy contractor, carpark epoxy contractor, carpark epoxy applicator, esd floor paint, esd floor coat, esd floor coatings, esd coating dubai, esd coatings in dubai, wood epoxy, wood epoxy in dubai, wood epoxy applicator, epoxy basement floor, epoxy basement floors, titanium and gunmetal metallic epoxy, titanium epoxy flooring, gunmetal metallic epoxy floor, polyaspartic top coat, polished concrete floor, polished epoxy, polished epoxy concrete, metallic epoxy, metallic epoxy in dubai, metallic epoxy in sharjah, polymer epoxy flooring brisbane, metal roof coating, epoxy flooring company in dubai, epoxy floor companies in dubai, industrial epoxy flooring companies in dubai, industrial epoxy flooring company in dubai, epoxy applicator in dubai, epoxy floor applicators in dubai, industrial epoxy floor applicators in dubai, epoxy flooring company in sharjah, epoxy floor companies in sharjah, industrial epoxy flooring companies in sharjah, industrial epoxy flooring company in sharjah, epoxy applicator in sharjah, epoxy floor applicators in sharjah, industrial epoxy floor applicators in sharjah, self leveling companies in dubai, self leveling company in dubai, self leveling applicator in dubai, self leveling applicators in dubai, self leveling companies in sharjah, self leveling company in sharjah, self leveling applicator in sharjah, self leveling applicators in sharjah, screed company in dubai, floor screed company in dubai, screed companies in dubai, floor screed companies in dubai, screed company in sharjah, floor screed company in sharjah, screed companies in sharjah, floor screed companies in sharjah, interlock companies in dubai, interlocking companies in dubai, interlocking company in dubai, interlocking fixer in dubai, interlock fixer in dubai, interlock fixing company in dubai, interlock fixers in dubai, interlocking fixing companies in dubai, interlock installer in dubai, interlocking fixers in dubai, fixers of interlock in dubai, fixer of interlock in dubai, interlock installation company in dubai, interlock installation companies in dubai, interlock installers in dubai, interlock tiles fixers, interlocking tiles fixers in dubai, interlock tiles fixers, interlock tile fixers, interlocking fixers in dubai, interlock fixer in dubai, interlock fixing companies in dubai, interlock installer in dubai, interlock installers in dubai, interlock suppliers in dubai, suppliers of interlock in dubai, interlocking tiles installers,      interlock company in dubai, interlock companies in dubai, interlocking companies in dubai, interlocking company in dubai, interlocking fixer in dubai, interlock fixer in dubai, interlock fixing company in dubai, interlock fixers in dubai, interlocking fixing companies in dubai, interlock installer in dubai, interlocking fixers in dubai, fixers of interlock in dubai, fixer of interlock in dubai, interlock installation company in dubai, interlock installation companies in dubai, interlock installers in dubai, interlock tiles fixers, interlocking tiles fixers in dubai, interlock tiles fixers, interlock tile fixers, interlocking fixers in dubai, interlock fixer in dubai, interlock fixing companies in dubai, interlock installer in dubai, interlock installers in dubai, interlock suppliers in dubai, suppliers of interlock in dubai, interlock tiles fixers, interlock suppliers in dubai, interlock fixing company in dubai, interlock installer in dubai, interlock suppliers in dubai, suppliers of interlock in dubai, interlock installation company in dubai, interlock suppliers in dubai, interlock tiles suppliers, interlock suppliers in dubai, interlock fixer in dubai, interlock fixing company in dubai, interlock installer in dubai, interlock suppliers in dubai, suppliers of interlock in dubai, interlock installation company in dubai, interlock suppliers in dubai, interlock tiles suppliers, interlock suppliers in dubai, interlock suppliers in dubai, interlock fixer in sharjah, interlock fixing company in sharjah, interlock installer in sharjah, interlock suppliers in sharjah, suppliers of interlock in sharjah, interlock installation company in sharjah, interlock suppliers in sharjah, interlock tiles suppliers, interlock suppliers in sharjah, interlock suppliers in sharjah, interlock fixer in sharjah, interlock fixing company in sharjah, interlock installer in sharjah, interlock suppliers in sharjah, suppliers of interlock in sharjah, interlock installation company in sharjah, interlock suppliers in sharjah, interlock tiles suppliers, interlock suppliers in sharjah, interlock suppliers in sharjah, interlock fixer in sharjah, interlock fixing company in sharjah, interlock installer in sharjah, interlock suppliers in sharjah, suppliers of interlock in sharjah, interlock installation company in sharjah, interlock suppliers in sharjah, interlock tiles suppliers, interlock suppliers in sharjah, interlock suppliers in sharjah, bricks tiles in dubai, interlock tiles dubai, interlock fixer in sharjah, interlock fixing company in sharjah, interlock installer in sharjah, interlock suppliers in sharjah, suppliers of interlock in sharjah, interlock installation company in sharjah, interlock suppliers in sharjah, interlock tiles suppliers, interlock suppliers in sharjah, behaton interlock, bishop interlock, cube interlock, fan interlock, florendo interlock, octagonal interlock, rock design, quodro interlock, uni decor interlock, square interlock, uni block interlock pavers in dubai, interlock company in dubai, sharjah, interlock fixing in dubai,sharjah, interlock fixing in dubai, sharjah, interlock tiles company in dubai, sharjah,. interlock fixing company in dubai, sharjah, interlock tiles installation in dubai, sharjah, interlock tiles installer in dubai, sharjah, interlock tiles installation company in dubai, sharjah, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai, Vinyl flooring in dubai, Vinyl flooring Uae, Grabo brand European quality Rubber flooring, Tuff brand Vinyl flooring, Talita brand vinyl flooring, Homogenious vinyl flooring in dubai UAE, LVT Vinyl flooring in dubai, Fineel rubber flooring in dubai, Sports flooring in Uae, Luxury vinyl flooring, AMTICO SPACIA UK Brand flooring, CAROLINA brand flooring, Florida UK brand Flooring, TARKETT sports flooring, Kids school specialist flooring, Badminton Flooring, Out door flooring, Internal flooring, epoxy flooring dubai, epoxy flooring uae, epoxy coating specialist, specialist epoxy contractor, epoxy professionals in dubai, epoxy flooring dubai, epoxy flooring sharjah, epoxy concrete paint, epoxy contractors, floor coating, floor coatings, floor coating contractors, floor coating contractors in dubai, floor coating contractors in sharjah, metal roof coating contractors, metal roof coating contractor in sharjah, roofing contractors, roofing coating, roof coatings, roof epoxy applicator, metal roofing applicator, decorative chip epoxy floor coating, concrete floor epoxy, maydos epoxy base floor, maydos epoxy contractor, maydos epoxy applicator, maydos epoxy contractor, carpark epoxy contractor, carpark epoxy applicator, esd floor paint, esd floor coat, esd floor coatings, esd coating dubai, esd coatings in dubai, wood epoxy, wood epoxy in dubai, wood epoxy applicator, epoxy basement floor, epoxy basement floors, titanium and gunmetal metallic epoxy, titanium epoxy flooring, gunmetal metallic epoxy floor, polyaspartic top coat, polished concrete floor, polished epoxy, polished epoxy concrete, metallic epoxy, metallic epoxy in dubai, metallic epoxy in sharjah, polymer epoxy flooring brisbane, metal roof coating, epoxy flooring company in dubai, epoxy floor companies in dubai, industrial epoxy flooring companies in dubai, industrial epoxy flooring company in dubai, epoxy applicator in dubai, epoxy floor applicators in dubai, industrial epoxy floor applicators in dubai, epoxy flooring company in sharjah, epoxy floor companies in sharjah, industrial epoxy flooring companies in sharjah, industrial epoxy flooring company in sharjah, epoxy applicator in sharjah, epoxy floor applicators in sharjah, industrial epoxy floor applicators in sharjah, self leveling companies in dubai, self leveling company in dubai, self leveling applicator in dubai, self leveling applicators in dubai, self leveling companies in sharjah, self leveling company in sharjah, self leveling applicator in sharjah, self leveling applicators in sharjah, screed company in dubai, floor screed company in dubai, screed companies in dubai, floor screed companies in dubai, screed company in sharjah, floor screed company in sharjah, screed companies in sharjah, floor screed companies in sharjah, interlock companies in dubai, interlocking companies in dubai, interlocking company in dubai, interlocking fixer in dubai, interlock fixer in dubai, interlock fixing company in dubai, interlock fixers in dubai, interlocking fixing companies in dubai, interlock installer in dubai, interlocking fixers in dubai, fixers of interlock in dubai, fixer of interlock in dubai, interlock installation company in dubai, interlock installation companies in dubai, interlock installers in dubai, interlock tiles fixers, interlocking tiles fixers in dubai, interlock tiles fixers, interlock tile fixers, interlocking fixers in dubai, interlock fixer in dubai, interlock fixing companies in dubai, interlock installer in dubai, interlock installers in dubai, interlock suppliers in dubai, suppliers of interlock in dubai, interlocking tiles installers,      interlock company in dubai, interlock companies in dubai, interlocking companies in dubai, interlocking company in dubai, interlocking fixer in dubai, interlock fixer in dubai, interlock fixing company in dubai, interlock fixers in dubai, interlocking fixing companies in dubai, interlock installer in dubai, interlocking fixers in dubai, fixers of interlock in dubai, fixer of interlock in dubai, interlock installation company in dubai, interlock installation companies in dubai, interlock installers in dubai, interlock tiles fixers, interlocking tiles fixers in dubai, interlock tiles fixers, interlock tile fixers, interlocking fixers in dubai, interlock fixer in dubai, interlock fixing companies in dubai, interlock installer in dubai, interlock installers in dubai, interlock suppliers in dubai, suppliers of interlock in dubai, interlock tiles fixers, interlock suppliers in dubai, interlock fixing company in dubai, interlock installer in dubai, interlock suppliers in dubai, suppliers of interlock in dubai, interlock installation company in dubai, interlock suppliers in dubai, interlock tiles suppliers, interlock suppliers in dubai, interlock fixer in dubai, interlock fixing company in dubai, interlock installer in dubai, interlock suppliers in dubai, suppliers of interlock in dubai, interlock installation company in dubai, interlock suppliers in dubai, interlock tiles suppliers, interlock suppliers in dubai, interlock suppliers in dubai, interlock fixer in sharjah, interlock fixing company in sharjah, interlock installer in sharjah, interlock suppliers in sharjah, suppliers of interlock in sharjah, interlock installation company in sharjah, interlock suppliers in sharjah, interlock tiles suppliers, interlock suppliers in sharjah, interlock suppliers in sharjah, interlock fixer in sharjah, interlock fixing company in sharjah, interlock installer in sharjah, interlock suppliers in sharjah, suppliers of interlock in sharjah, interlock installation company in sharjah, interlock suppliers in sharjah, interlock tiles suppliers, interlock suppliers in sharjah, interlock suppliers in sharjah, interlock fixer in sharjah, interlock fixing company in sharjah, interlock installer in sharjah, interlock suppliers in sharjah, suppliers of interlock in sharjah, interlock installation company in sharjah, interlock suppliers in sharjah, interlock tiles suppliers, interlock suppliers in sharjah, interlock suppliers in sharjah, bricks tiles in dubai, interlock tiles dubai, interlock fixer in sharjah, interlock fixing company in sharjah, interlock installer in sharjah, interlock suppliers in sharjah, suppliers of interlock in sharjah, interlock installation company in sharjah, interlock suppliers in sharjah, interlock tiles suppliers, interlock suppliers in sharjah, behaton interlock, bishop interlock, cube interlock, fan interlock, florendo interlock, octagonal interlock, rock design, quodro interlock, uni decor interlock, square interlock, uni block interlock pavers in dubai, interlock company in dubai, sharjah, interlock fixing in dubai,sharjah, interlock fixing in dubai, sharjah, interlock tiles company in dubai, sharjah,. interlock fixing company in dubai, sharjah, interlock tiles installation in dubai, sharjah, interlock tiles installer in dubai, sharjah, interlock tiles installation company in dubai, sharjah, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai,interlock company in dubai, interlock fixing in dubai, interlock fixing in dubai, interlock tiles company in dubai, interlock fixing company in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock tiles installation company in dubai, interlock fixing, interlock fixing in dubai, interlock installation in dubai, interlock installer in dubai, interlock tiles installation in dubai, interlock tiles installer in dubai, interlock contractor in dubai  
Posted On :6 months ago


Posted On :6 months ago

ASTM A53 Grade Pipes, Tubes in Oman

This specification covers seamless and welded black and hot-dipped galvanized steel pipe in NPS 1/8 to NPS 26. The steel categorized in this standard must be open-hearth, basic-oxygen or electric-furnace processed and must have the following chemical requirements: carbon, manganese, phosphorus, sulfur, copper, nickel, chromium, molybdenum, and vanadium. The tubing shall undergo a seamless or welding process. Tension, bend, and flattening tests shall be performed to make sure that it must adhere to the mechanical properties of the standard. The hydrostatic test shall be applied, without leakage through the weld seam or the pipe body. Nondestructive electric test shall be made to make sure that the full volume of the pipe must be in accordance with the standard. The purchaser shall have the right to perform any of the inspections and tests set forth in this specification where deemed necessary to ensure that the pipe conforms to the specified requirements.ASTM A53 Grade B carbon steel pipes are widely available and relatively affordable, making it a popular choice for very large projects such as pipelines. Steelmet stocks and supplies full range of ASTM A53 Grade B pipes and tubes. ASTM/ASME A53/SA53 grade seamless pipes is one of our most widely used grade of carbon steel and is readily available ex-stock for all standard thicknesses up to SCH160. Steelmet Industries is a reputed distributor of ASTM A53 Grade B pipes manufactured by manufacturers in India such as MSL, ISMT and JINDAL SAW.ASTM/ASME A53/SA53 carbon steel seamless pipes are used in industrial applications involving high heat, including process piping, boiling plants, compression stations and refineries.ASTM A53 Seamless Steel Pipes, ASTM A53 Seamless Steel Tubes Chemical CompositionGradeChemical Composition (%) Max.CMnPSCuNiCrMoVA0.250.950.050.0450. A53 Seamless Steel Pipes, ASTM A53 Seamless Steel Tubes Mechanical PropertiesGradeMechanical Properties, Min.Tensile Strength(Mpa)Yield Strength(Mpa)A330205B415240ASTM A53 Grade B Steel Pipes, ASTM A53 Grade B Steel Tubes Specifications, Stock And Supply RangeASTM A53 Grade B Carbon Steel PipesSize Range: 1/2” NB to 36” NBThickness: SCH 40, SCH 80, SCH 160, SCH XS, SCH XXS, All SchedulesApplications: Oil Refineries, Petrochemicals, Power Generation (Nuclear/Thermal), Steel, Sugar, Boiler Equipments, Pressure Vessels and General Engineering PurposesEnd Connections for Line Pipes: Plain, Bevel, Screwed, ThreadedType: Seamless / ERW / Welded / Fabricated / CDWForm: Round Pipes/Tubes, Square Pipes/Tubes, Rectangular Pipe/Tubes, Coiled Tubes, “U” Shape, Pan Cake Coils, Hydraulic TubesLength: Single Random, Double Random & Required Length, Custom Size – 12 Meter lengthsEnd: Plain End, Beveled End, TreadedEnd Protection: Plastic CapsOutside Coating: Black Painting, Anti-Corrosion Oil, Galvanised Finish, Finish as per customer RequirementsInspection, Test Reports: Mill Test Certificates, EN 10204 3.1, Chemical Reports, Mechanical Reports, PMI Test Reports, Visual Inspection Reports, Third Party Inspection Reports, NABL Approved Lab Reports, Destructive Test Report, Non Destructive Test Reports, India Boiler Regulations (IBR) Test CertificatePacking: Packed in Wooden Boxes, Plastic Bags, Steel Strips Bundled, or as per Customers RequestsSpecials: Sizes and Specifications other than above can be manufactured on request
Supplier : Steelmet Industries MUMBAI
Posted On :6 months ago


Supplier : Gulf Safety Electromechanical (info@gulfsafetyuae.com) ABU DHABI
Posted On :6 months ago

Precious Metal

Gold BarPurity 96.8%Karate 22 plus
Supplier : Atlas Precious Mettals DMCC DUBAI
Posted On :6 months ago

Stainless Steel Fasteners

We are one of the leading Manufacturers, Suppliers & Exporters of Fasteners in different shapes and sizes and with different specifications as per the customers’ requirement. These Fasteners are characterized by high durability, resistance to corrosion, flawless finish and complete reliability in service. Our complete range is stringently tested by our well equipped testing unit, to ensure their compliance with international quality norms. These Fasteners are used in various industries like Oil & gas, Petrochemical, Pharmaceutical, Fertilizers, Construction, Food, Power and Instrumentation.Size : M5 to M50Types : Bolts, Nuts, Screws, Sockets, Studs, Screw, Hex Set Screw, Socket Screw, Cap Screw, Pan Head Screw, Machine Screw, Socket Head Cap Screw, Allen Cap screw, Wing Screw, Washers, Spring Washers, Studs, Anchors, Marine Anchors, Nut, Hexagon Nut, Hex Nut, Hex Coupling Nut, Hex Domed Cap Nuts, Square Nut, Stud Bolts, Hex Head Bolts, Socket Hexagon Head Screw Anchor Bolt, U- Bolts, J Bolts, Mushroom Head Square Neck Bolts, T-Head Bolts, Wing Screw, Eye Bolt, Foundation Bolts, Structural Bolts.Stainless Steel : ASTM A193 202, 304, 304L, 304H, 316, 316Ti, 316H, 316L, 316LN, 309S, 309H, 310S, 310H,317, 317L, 321, 321H, 347, 347H, 201, 202, 904L
Posted On :7 months ago


Butyl Corrosion Tape used as an anti-corrosive coating, waterproofing, moisture/vapour sealing system in the pipelines, building and construction industriesButyl Sealant Tapes
Supplier : AL SAD Importing & Trading Est. (AL SAD) ABU DHABI
Posted On :7 months ago

Portacabin in Oman

Portacabin Manufacturer and Supplier in Dubai UAE Oman Saudi QatarHome/Portacabin Manufacturer and Supplier in Dubai UAE Oman Saudi Qatar Portacabin Manufacturer and Supplier in Dubai UAE Oman Saudi Qatar Ghosh Group 2017-01-18T16:46:36+00:00 Portacabin Manufacturer and Supplier in Dubai UAE Oman Saudi QatarGhosh Metal Industries LLC, Ajman, Dubai, United Arab Emirates are one of the top supplier and manufacturers of prefabricated Portacabin.This Portacabins meets the demands in construction sites, security cabins, factories, toll booths and other similar areas where permanent construction is not required and useful.Ghosh Metal Industries – Portacabin Manufacturer and Supplier in Dubai UAE Oman Saudi Qatar operations are run by our expert who have rich experience in this portable industry sector. The best practice process guidance as well as years of experience provide them to deliver compatible solutions as and when demanded by our customers.Ghosh – Portacabin is fabricated from hot rolled quality steel duly welded, comprising of base frame, peripheral structure, self draining roof, entry doors and windows (as per our valuable customer requirement). All The corners shall be sufficiently strengthened to facilitate transportation, lifting and placing on site.Ghosh Metal Portacabin Manufacturer and Supplier – United Arab Emirates portacabins base frame shall be made of mild steel channel section. The main structural element shall be of 100 mm x 50 mm ‘C channels and cross support of ‘C’ channels section size 75 mm x 40 mm with Extra Leg.Ghosh Group Portacabin’s side and end frame shall be made out of pressed sections of suitable pillars of high strength.Exterior wall shall be made up by 12 mm to 20 mm Cement Board / Gypsum Board / MDF board or Flat Sandwich panel top and bottom with Aluminium or GI Pre painted Sheet with 50 to 100 mm PU, subject to our customer request.The Flooring System of Ghosh Group – Portacabin Manufacturer and Supplier in Dubai UAE Oman Saudi Qatar – maintains minimum space on the bottom frame 20 mm thick plywood, bison panel/cement. Fiber board shall be fixed by means of self taping screw.Roof shall be made out by Single Skin Roof Profile Sheet or Roof Sandwich panel subject to our valuable customer choice, with epoxy paint on galvanized or aluminium subtract.The interior of Ghosh Group Portacabin shall be aesthetically finished so as to give custom built appearance with extremely high quality workmanship. All vertically and horizontal corners shall be neatly and smoothly finished with Powder coated aluminium works.The door shall be of external opening type made out of the same material as wall panels with door closing unit. The construction of the door shall be double skin steel construction with 50 mm thick PU insulation. Aluminum powder coated windows, sliding type shall be provided – made of aluminium , 6 mm thick, tinted glasses will be fitted on it.Portacabin electrical work is always done with high care with the bunk house, provided with electrical wiring suitable for 250 Volt, 50 HZ / 60 HZ to support electric generator, single phase AC power supply.All electrical wiring shall be concealed. Suitable copper cables shall be used for lighting circuits. The copper cables used will be of 3/19 cable for lighting circuits. ISI mark and concealed in PVC conduits insulated copper wire shall be used for wiring to be done in PVC conduit with small size distribution board with MCB, protection and to separate with main supply.Ghosh Group – Standard Portacabin size for the site construction office in Dubai, UAE, Abu Dhabi, Qatar, Oman, KSA is 3 meter width x 6 meter length / 3 meter Width x 9 meter Length / 3 meter Width x 12 meter Width (1 Room, 2 Room, Bathroom). .fusion-button.button-1 .fusion-button-text, .fusion-button.button-1 i {color:#fcfcfc;}.fusion-button.button-1 {border-width:0px;border-color:#fcfcfc;}.fusion-button.button-1 .fusion-button-icon-divider{border-color:#fcfcfc;}.fusion-button.button-1:hover .fusion-button-text, .fusion-button.button-1:hover i,.fusion-button.button-1:focus .fusion-button-text, .fusion-button.button-1:focus i,.fusion-button.button-1:active .fusion-button-text, .fusion-button.button-1:active{color:#ffffff;}.fusion-button.button-1:hover, .fusion-button.button-1:focus, .fusion-button.button-1:active{border-width:0px;border-color:#ffffff;}.fusion-button.button-1:hover .fusion-button-icon-divider, .fusion-button.button-1:hover .fusion-button-icon-divider, .fusion-button.button-1:active .fusion-button-icon-divider{border-color:#ffffff;}.fusion-button.button-1{background: #138ccc;}.fusion-button.button-1:hover,.button-1:focus,.fusion-button.button-1:active{background: #1a80b6;}.fusion-button.button-1{width:auto;} ENQUIRE FILL THE FORM or .fusion-button.button-2 .fusion-button-text, .fusion-button.button-2 i {color:#fcfcfc;}.fusion-button.button-2 {border-width:0px;border-color:#fcfcfc;}.fusion-button.button-2 .fusion-button-icon-divider{border-color:#fcfcfc;}.fusion-button.button-2:hover .fusion-button-text, .fusion-button.button-2:hover i,.fusion-button.button-2:focus .fusion-button-text, .fusion-button.button-2:focus i,.fusion-button.button-2:active .fusion-button-text, .fusion-button.button-2:active{color:#ffffff;}.fusion-button.button-2:hover, .fusion-button.button-2:focus, .fusion-button.button-2:active{border-width:0px;border-color:#ffffff;}.fusion-button.button-2:hover .fusion-button-icon-divider, .fusion-button.button-2:hover .fusion-button-icon-divider, .fusion-button.button-2:active .fusion-button-icon-divider{border-color:#ffffff;}.fusion-button.button-2{background: #138ccc;}.fusion-button.button-2:hover,.button-2:focus,.fusion-button.button-2:active{background: #1a80b6;}.fusion-button.button-2{width:auto;} CALL US(works on mobile or calling device)We Ghosh Group team welcome your enquiries for any sort clarification. You can feel free to contact or write us on +971553258409 or email at parimal@ghoshgroups.com. We would be love to assist you with any clarification you need.
Posted On :7 months ago


Om tubes and fittings are specialized manufacturers, dealers of premier quality Carbon Steel Elbow Fittings. We majorly emphasize on consistent improvement and provide with the best service ever. Our processes make us stand out from the rest of the lot. At Om tubes, our process consists of procedural development cycle: designing (customization provided), the engineering process, the machining process, assembling the parts, testing (hundred percent in house), packing and warehousing, logistics and documentation process. We stock the largest inventory of products ready for immediate delivery. We have the best team from manufacturing to dispatch, who have made us what we are today. We provide Carbon steel elbows in various grades, size, cuts, according to the customer’s specifications. Our adherence to strong values, has made our brand stand up among-st the others. We regularly review our processes, and maintain a strong, stable management team. We have a pioneering way of delivering our products, along with the affordable price of our products, which makes us a good choice. 
Supplier : Om Tubes & Fitting Industries MUMBAI
Posted On :7 months ago

Cleaning services

Supplier : Mass Security Services L.L.C DUBAI
Posted On :7 months ago


Posted On :7 months ago


GOLDEN LIGHTS TRADING LLC POST BOX # 27529, DUBAI, UAE Tel: +971 4 2257673 Fax: +971 4 2257981 Email: sheerazi@eim.ae Email: info@goldenlightuae.com URL: www.goldenlightuae.com
Posted On :7 months ago

Kranzle High Pressure Pump MADE IN GERMANY

Outstanding quality and technical perfection!High-pressure cleaners, industrial vacuum cleaners and hand power sweepers – that is the world of Kränzle. Founded in 1974the Kränzle enterprise has developed into a worldwide quality leader of high-pressure cleaners. And there is a good reason for this. Because, from the start, Kränzle has attached great importance to highest quality, e.g. with regard to the selection of a forged special type of brass for its high-pressure pumps or the ceramic coating of the pump plungers - top quality is the uncomprisingly clear brand standard.Based on values such as quality, flexibility and innovation, we continuously focus on the further development of our company and product solutions and, in this context, exclusively rely on qualified specialized partners and agencies all over the world.Your Kränzle team wishes you much pleasure and success with our products!
Posted On :7 months ago

ARO Piston Pumps by Ingersoll Rand

By Technology:Pneumatic Piston PumpHydraulic Piston PumpBy Type:2 ball Piston Pumps4 ball Piston PumpsChop-check Piston PumpsBy Mounting  / Orientation:Drum Mounted PackagesWall Mounted PackagesFloor Mounted PackagesCart Mounted PackagesSingle Post Ram PackagesTwo Post Ram PackagesSkid Mounted PackagesBy Application:Lubrication PumpsSealant Transfer PumpsHigh Pressure PumpsHeavy viscous fluid transfer pumpsHigh Pressure Wash Pumps / cleaning pumpsAirless Spray Paint Pump PackagesSingle component pump packagesTwo-component pump packagesMulti-component pump packagesDrum Agitator & Lift PackagesCart Mounted Lift PackagesExtrusion PumpsFor over 85 years, the ARO® Fluid Products business of Ingersoll Rand® has developed partnerships with more than 200 original equipment manufacturers and distributors, enabling us to better focus on the unique pumping needs of many industries. It’s a strategic merger of our partners’ application expertise, along with our decades-long legacy of designing and building outstanding piston pumps.
Supplier : ARO Pumps by Ingersoll Rand DUBAI
Posted On :7 months ago


automotive dmmdmm multimetermicrofarad testerac dc voltage testerfluke toolsfluke tachometerfluke 335 clamp meterac leakage current testerused fluke metersvoltalert 1ac-a iifluke clampfluke dmm 179multimeter wiresmultimeter frequencyfluke 179 accessoriesContact Us For More Information:SYNERGIX INTERNATIONAL LLCPO Box 29187 #2305, 23rd Floor, Palace Towers Dubai Silicon Oasis, Dubai, UAE Dubai United Arab EmiratesTel: 00971 4 320 6053Mob: +971 56 170 0430Web: www.synergix-int.comEmail: enquiry@synergix-int.com / info@synergix.ae
Supplier : Synergix International LLC DUBAI
Posted On :8 months ago

Industrial Washing machines

mplements and modernizes complete systems. We focus on resource conserving consumption and environmentally compatible water treatment: integrated recovery systems ensure that you save energy, water and chemicals. First time in India, we have designed, manufactured and have commissioned of modular wet treatment systems. It stands for perfect corrosion protection of Metal parts, body and for its quality and value retention.Throughout the ent i re c leaning, pretreatment and ED process we make sure that all components interact perfectly. With standardized components and parts - designed, integrated and implemented by smooth interfaces and process sequences are assured
Posted On :8 months ago

Ohns Round Bar

Ohns barsSize : 6 mm to 300 mmQuality : Ohns Length : 2 mtr to 6 mtrFinishing : forging, Black, BrightAdditional Information:Minimum Order Quantity: 1 Kilogram
Posted On :8 months ago

Warning and Special offer Tape supplier in UAE

Product Benefits Material – Linear low density polyethylene Lead free pigments with virgin grade film Soil tolerance from pH 2.5 to pH 11.0 inclusive Warning mat printed with any text & any language with various sizes & colors as per tailor made specifications 100 micron grade is manufactured in accordance with ENATS 12-23 specification Special manufacture available Model Size Micron Core Size Pack S-1019 2/1”× 40/60 yds 100 3 mm 1×192 Long Description Warning tape is a coloured polyethylene underground marker tape with a printed warning message for marking underground buried services. A quick, easy and inexpensive way to mark aisles and physical hazards. This highly visible, pressure-sensitive vinyl tape is self-wound with a permanent adhesive, and is protected with an abrasion resistant clear laminate that resists oil, dirt and chemicals Boddingtons underground warning marker tape is an economical way of warning excavators of buried pipes and cables below ground. warning tapes can be manufactured with any text, in any language, any color and size manufactured to your specification.
Posted On :8 months ago


Diesel Power Plant Hire from 1 MW to 100 MW Temporary Power from 1 MW to 100 MW Solar Hybrid Rental Power plantsSupply of Diesel Generator on Hire including: 50 kVA Diesel Generator80 kVA Diesel Generator100 KVA Diesel Generator125 kVA Diesel Generator250 kVA Diesel Generator300 kVA Diesel Generator360 kVA Diesel Generator500 KVA Diesel Generator800 kVA Diesel Generator1000 KVA Diesel Generator1250 KVA Diesel GeneratorGas generators Hire
Supplier : SES Smart Energy Solutions Fzco DUBAI
Posted On :8 months ago

Refrigerated Truck,Chiller van,Freezer pallet pickup,Reefer Trailer,Catering transport rental UAE

Refrigerated Truck Transport, Chiller Van, Freezer Pickup and Catering Services, Reefer Trailers Rental, Logistics and Road Freight services, Delivery services Dubai UAE Fresh Freights Handling frozen food with care Fresh Freight Refrigerated /Chiller /Freezer Transport Services Dubai, Abu Dhabi UAE Fresh Freight Refrigerated Transport is a reputed Refrigerated land transporting company since 2009, located Al Quoz Industrial area 4 Dubai. We have a good exposure in the field of trucking, Freezer Truck, Chiller van, refrigerated truck, Freezer Pick up, Reefer Trailers, Catering Services to GCC and inside UAE, Dubai and Abu Dhabi.   Our trucking services included:                                                                  ·       Chiller Van 1 ton and Refrigerated truck 3/4/7/10 ton truck/pickups for local & GCC trips ·       Reefer trailers (12.5 & 13.6 Mtr Length / 2.7 Mtr Width) i.e. 40 – 45 feet trailers ·       Open trailers: Flat and Box trailer (12 & 15 Mtr Trailers) i.e. 40 - 50' trailers ·       Closed trailers: Reefer and curtain trailers ·       Low bed trailers (30 - 100 Ton capacity) ·       car recovery and car carriers ·       Pickups (3, 7, 10 ton) ·       Catering and Event transportation providers in Abu Dhabi and Dubai ·       Logistics and road freight ·       Medical Transportation under temperature control vehicles We will carry your head ache by providing excellent services like on time place the trailers, any time call answer from operation and daily track record by mail to your desk and more. We can provide cash and credit business with reasonable rates.   Contact: Mr. Taj Afridi (Business development executive)  Mob #: 050-8163228 Email: hire@freshfreights.com / info@freshfreights.com    Please note that if you have any requirements please call or mail to us with following details: Place of loading and destination Description of materials Weight and dimension of cargo Palletized or Not. Type of truck and no. of requirements Date of loading Final destination clearances Hope the best   Watch us on: http://www.youtube.com/watch?v=3s6GtAPTl1Q We are committed to provide professional services, we are a call away. Daily Basis Rental Monthly Basis Yearly Basis   Contact Us: We work based on your quotation, please contact us on the following numbers: Mob: 055-8413124 Mob: 050-8163228 E-mail: hire@freshfreights.com/info@freshfreights.com Web: http://www.freshfreights.com
Supplier : Fresh Freights refrigerated transport L.L.C DUBAI
Posted On :9 months ago

Tube Connection NRV

Kalpataru Piping Solutions is one of India's leading manufacturers of high quality Tube Connection NRV Check Valves. Tube Connection NRV Check Valves are utilized to avoid stream inversion in piping systems.They are appropriate for administration in level or vertical (flow up through valve only) piping tuns. Tube Connection NRV Check Valves have low weight drop and are most appropriate for moderate speed applications.SPECIFICATIONSSize : Series of end connection 1/8" to 1" npt, bsp, male & female 1/4" to 1" single & twin ferrule tube end.Temperature Rating : Neoprene Rubber 0℃ To 100℃, Silicon 0℃ To 150℃, Viton Seal 0℃ To 190℃Pressure Rating : 0 To 6000psiCracking Point : (.02 To 1 .75 Bar) Or As per customers requirements.Available in : ss, brass & ms deffernet models as per demanding.Test Certificate : 100% factory tested.APPLICATIONS :1. Paper Industry, Steel Plant manufacturer, Power Pack Manufacturer.2. Aircraft construction equipments, SPM, Process Machineries, Hydraulic Power Booster Units.3. Utlise for Oil & gas Industry, Marine Application, Petrolium Equipments, Oil Refineries, Water Industry.4. They are also commonly found in Paper Industry, Steel Plant manufacturer, Power Pack Manufacturer, Aircraft construction equipments, SPM, Process Machineries, Hydraulic Power Booster Units.
Supplier : kalpataru piping solutions MUMBAI
Posted On :9 months ago

PVC Curtain in Dubai

Name :- Prajeesh p v (Senior Marketing Manager)Phone :-  0503874001/0557334990 Email :- wesupplyuae@gmail.comPVC strip curtain / Cold Store Strip curtain.Available in standard rolls - Plain or Ribbed type- Length 50metresSize : 200mm x 3mm thickSize : 300mm x 3mm thickSize : 200mm x 2mm thickSize : 300mm x 2mm thickCommercial air curtains and industrial air curtains Mounting height 2meters to 8metersLength 600mm ,900mm,1000mm,1200mm,1500mm,1800mm,2100mm,2400m mmCold air curtains And hot air curtains
Supplier : WeSupply General Trading FZC AJMAN
Posted On :10 months ago

Pipes and Tubes

We have ready stock for Stainless Steel Pipes and Tubes in Seamless and Welded form ranging from 10 MM OD to 20" NB sizes. We request you to please send us any of your details requirement for Pipes and Tubes, Hollow section. All material will be with MTC as per ASTM 312/213 
Supplier : Renaissance Metal Craft Pvt. Ltd. MUMBAI
Posted On :10 months ago

tent manufacturer sharjah

Dear Customers,         APM shades specialized to make car park shade, sun shade, tents, canopies,awning, majlis tents, Aluminium Doors, Aluminium Windows, Aluminium Partition, Gypsum partition, Frame-less Glass Partition and Aluminium Louver works,Please visit our website for more detail :apmshades.wixsite.com/apmshades orPlease Call our sales HeadMr. Murugan AP,apm shades - FZE,Tel: +971 6 766 2614Mobile:​ +971 55 1668143Email: murugan@apmshade.com
Posted On :10 months ago


Posted On :10 months ago


Delta 2000 ManualManual key cutting machine for cylinder door and car keys, four sided jaws, chipping tray and brush on board.
Supplier : Sadeem Building Material Trading Co DUBAI
Posted On :10 months ago


Supplier : Super Perkins Facilities Management & Services L DUBAI
Posted On :10 months ago


We do all type of pvc doors for kiosks,plz call 00971-55-5680048
Posted On :10 months ago


Contact :   Mr. CECIL SAMUEL                     Tel #      :   0097126737900   Website     :   http://acecentro.com/Cell #     :   00971555180550                           Email    :   sales@acecentro.comCHEMICAL ADDITIVES FOR SHOTCRETING Ace Centro Enterprises (ACE) supplies self-propelled concrete spraying equipment for the civil construction and tunneling industry. The 4 section telescopic boom offers a reach of 9 metre, all controlled single handedly with a user friendly wireless remote. The track mounted unit is specifically designed with a dual power system, offering diesel engine drive, as well as, electric motor drive. This electric drive feature, is ideal whilst operating inside tunnels, underground and confined spaces.Site conditions:-    A shotcrete spray team typically comprises of 3 nozzle men, who take turns at the gun to overcome fatigue. This increases labour cost.-    Productivity achieved by manual spraying, is approximately 3 to 4 m3/hour.-    Periodic rotation of Nozzle Man due to fatigue, causes inconsistent and uneven spraying of concrete, thereby resulting in wastage of material.-    Scaffolding platforms or man basket suspended from a crane, are required while spraying at heights. This involves additional equipment and increases project costs.-    Overhead shotcreting inside tunnels, subways and underground shafts is extremely tiresome for a Nozzle Man.Solutions & Benefits:-    ACE’s hydraulic spray arm is remote control operated by 1 person.-    Since there is no restriction to the amount of material passing through the Hydraulic Spray Arm, the pump’s capacity is the only limitation in terms of productivity. Spraying of 12 to 14 m3/hour can be achieved.-    Automated spraying with the telescopic spray arm, facilitates even spraying, better finish and less rebound.-    The 4 section telescopic arm sprays up to heights of 9 metre, without the need of any scaffolding.-    Simple toggling with the remote control, moves the hydraulic manipulator nozzle around bends and overhead surfaces, especially whilst working inside tunnels and confined areas. This offers the nozzle man safety and ease of operation.Through its sales organization in the Arabian Gulf, ACE also supplies shotcrete pumps and gunite machines to its clients in the Middle Eastern and African markets for underground metro projects, slope stabilization, shore piling works.Please contact us on +971 55 5180550 or sales@acecentro.com with your requirements and we will be glad to provide you with an offer to suit your project.
Posted On :10 months ago

Roots Multiclean Uae

Posted On :10 months ago


MC67MOBILE COMPUTERGive your field workforce the tools they need to work faster and smarter with the rugged 4G HSPA+ MC67. This fully-featured powerhouse of a device lets workers access information in your backend system; scan practically any barcode in almost any condition; capture documents to simplify recordkeeping; take and send video and photos for real-time repair support; and call a customer with an arrival window.With the MC67 dual wireless WAN modem configuration, you can choose the cellular network that will provide each worker with the best coverage — 4G GSM or 3.5G CDMA* — or both. The software-configurable cellular radios can be activated and reactivated on different networks on the fly.*CDMA EVDO Rev A activation only available with Verizon in North AmericaFEATURES & BENEFITSHigh-speed cellular and Wi-Fi wireless connections 4G HSPA+, 802.11a/b/g/n, Bluetooth 2.1 EDR and best-in-class GPS brings your workers the best voice, data and peripheral connections available.Our most rugged compact mobile computer Workers can drop the MC67 on concrete or in water, use it in the heat, cold, rain, snow and more, and still expect reliable operation.A brilliant display for easy reading The 3.5 in. resistive display is exceptionally bright for easy reading, even in bright sunlight, with the power efficiency required to maximize battery cycle times.Advanced scanning technologyNo matter what type of barcode your workers need to scan, the MC67 can capture it. Scan 1-D and 2-D barcodes at laser speed — even if the codes are dirty, damaged or poorly printed. With multiple scan engine options, you can tailor the MC67 to provide the best performance on the types of barcodes in use in your enterprise.Advanced document capture technology Our state-of-the-art mobile document capture software combines with the 8 MP high resolution camera to enable easy capture of documents at the point of transaction and reduce paper handling.The power you need to support virtually any application Workers enjoy best-in-class performance with plenty of room for multiple apps, photos, databases and more with the dual core 1 GHz processor and the most memory in this class.Android fortified for the enterprise Extensions (Mx) from Zebra Technologies transforms Android from a consumer operating system (OS) to a true enterprise-class OS with a series of additional features and options that improve security, device management and support for advanced enterprise data capture.RhoMobile Suite supported RhoMobile Suite applications will run on both MC67 Android and Windows Embedded Handheld devices.
Supplier : Datametric Technologies LLC DUBAI
Posted On :10 months ago


CABLE & WIRE MANUFACTURERS   House Wire  Panel Copper Cable  Flexible Copper Cable  Copper Armload Cable  Aluminium Armload Cable  Telephone Cable  Lan Cable
Posted On :10 months ago

Stainless Steel Forged Fittings

Our range of Stainless Steel Forged Fittings includes - 45° and 90° elbows, equal and reducing tees, couplings, hexagon and reducing nipples, crosses, street elbows, caps, plugs, hexagon bushes, unions, concentric and eccentric swage nipples, pipe nipples and forged outlet fittings.Dimensional Standards: ANSI B16.11, BS3799, MSS SP79 and MSS SP97 Pressure Ratings: 3000#, 6000# and 9000#Size: ¼” to 4” NBGrades: ASTM A182 F304/L & F316/L
Posted On :10 months ago

Inconel 625 SMS Pipes

We are one of the leading manufacturers, suppliers and exporters of optimum grade Inconel 625 SMS Pipes. These pipes are provided o customers in various sizes, lengths, thicknesses and designs at market leading prices. In addition to this, our pipes are delivered at clients’ end within the stipulated time frame.Features:Rust proofDimensionally accurateMaintenance freeSpecifications:Size: 1/2' to 3'Manufacturing Process: SMLS PipesSch: 10 To 80
Posted On :10 months ago

JT N4 PVC Sheet 2mm

Product Details:Thickness(mm)2 to 3FeaturesPVC CoatedProduct Description:Stainless Steel 202 sheet (jindal terms it as JT Grade)Surface condition - N4 with pvc coatingjindal mill tc will be provided
Posted On :11 months ago

Intercare Air Freshener Refill-Astonish

Astonish : A mix of perfumes with notes of a fresh floral bouquet. A potpourri of fresh spring flowers. With malodour counteractant. No CFC’s or ozone depleting substances.  www.intercare-homedelivery.aeEMAIL: sales@intercare.ae00971-6-5345500
Supplier : Intercare Limited SHARJAH
Posted On :11 months ago

Kitchen Tiles

When kitchen cabinetry is relatively simple and unadorned, you can easily opt for more pattern on the backsplash. Here, 1-inch glass mosaic tile creates a dramatic backdrop for the kitchen's white cabinets. The backsplash's neutral hues also blend well with the kitchen's gray countertops and stainless-steel appliances.Subway tile in different shades of green wrap the kitchen, adding earthy tones and a burst of color to the white space. The combination of light and dark shades keeps the kitchen from becoming too heavy or too airy. The green tiles and the warm wood floors give the kitchen a natural, outdoorsy feel.Let nature inspire your backsplash design. In this kitchen, a riverside setting spurred a placid palette. Blue glass subway tiles saturate the backsplash with color and look reminiscent of water -- even offering a sense of depth. The pale hue promotes an air of serenity for the space and softens the look of the hardworking range area, giving it a more casual feel.
Supplier : Winsun Ceramic Pvt. Ltd. MORBI
Posted On :11 months ago


About Us Souvenir Building Materials is a professionally managed group run by some of the experts in the field of protective industrial equipment. Based in Dubai, our range of personal safety products includes - industrial safety shoes, industrial helmets and industrial garments.As a premium manufacturer & stockist of industrial safety products like industrial safety shoes, industrial helmets and industrial garments, we have our associates all around the world and we also have sourcing rights of all our products from China and India. Our job includes product research and development, sourcing, merchandising and quality assurance. We export our range of CE Approved products to the local as well as international market. We have a strong customer base all around the world ( 300 customers only in Dubai ).Our efforts for total customer satisfaction are driven by principles of ethical business approach, respect & dignity for individuals and concern for environment & society at large. We make progressive use of technology to achieve functional excellence in our work and create sustainable value for our clients.Our constant quest for excellence and a will to scale new heights has made us a name to reckon with. We, along with our sister concern, have today internationally become one of leading exporters and suppliers, offering a wide range of products to the international market.We also handle all export-related documents to assure our clients that the products reach them on time. We have updated regulatory approvals from some of the renowned organization to export our products all over the world.Our philosophy is to spend maximum possible time with our vendor partners and the client for sharing ideas and guiding them.Our ProductsPU / TPU Outsole ShoesPVC Outsole ShoesRubber Outsole ShoesIndustrial GarmentsSafety HelmetsOur Business overviewComplete knowledge about the industrial safety products and industrial garment market.Enjoy high credibility with some of the well known overseas retail chain storesWork with some of the over 45 factories across India.Strong relationships with factoriesAbility to guide factories on manufacturing and packaging products in tune with our buyers requirements.Our strengths: What makes us a beneficial business partnerCustomization of productsOur technicians help us to develop all products as per our customers specifications. The goods are fabricated under the supervision of our technical people who represents us in the factory.Warehousing FacilityOur warehouse is well equipped with proper storing facility. We can deliver our products faster as per our customers requirements.Excellent Logistics SupportOur organization is committed to offer effective, efficient and economical shipment and air freight forwarding of the products to our esteemed customers. Through our constant efforts, we strive for continual improvement and increased customer satisfaction. Our strong trading / marketing and service support have enabled us to cater our clients with high level of satisfactionNo Minimum Order QuantityWe give utmost respect to all our clients with whatever order they place. Each and every order placed by our esteemed customers is important to us. Uncompromising attention and adherence to specifications ensures us to deliver the best possible quality of products to our customers.Quality OrientationWe believe in the essence of building quality in our wide range of products. Our products has been approved by European and Asian standard norms. To maintain our standards of high quality, we are committed to exceed the quality requirements of our customers, which can only be achieved by using best quality materials, exacting manufacturing standards and constant quality measurements. Each product passes stringent quality control tests and procedures. Strict quality standards helped our products to have CE approvals to export them.Our Network and Tie upsWe boast of having our tie ups with some of the well known manufacturing units in India and China. These units are well equipped with a modern set up of production with state-of-the-art machinery and have in house plant facilities to fabricate these products. The entire production is done under the supervision of our technical persons.Our wide network is spread all over 20 countries, which helps us to reach our customers faster. Moreover, our total commitment to quality, innovation and extensive dealer network have helped us to deliver quality products to our vendors within the stipulated time period.Our business projections for the current Financial YearIn this competitive market our ability to grow in Dubai is tremendous. We keep on adding new products to our product range. We are expecting a sales turnover of almost AED 74 million (US $20million) during the 2006-2007 financial year.Our ClientleWe adhere to the principles of mutual benefit, contract honoring and honesty which help us to build everlasting relations with our customers and take pride in satisfying their diverse needs. Our roster of clients includes leading retailers from UAE, Qatar, Onam,Nigeria, China, India, Libiya, Saudi Arabia, Kuwait, Behran, Kazakhistan, Pakistan, South Africa, U.K. And U.S.A.
Supplier : Souvenir Building Materials LLC DUBAI
Posted On :11 months ago

Stainless Steel Pipes

We are an eminent organization engaged in manufacturing, supplying and exporting a quality assured array of Stainless Steel Pipes. The offered pipes are known for being in-line with internationally laid quality norms as these are manufactured using high grade raw material. We also test these pipes prior to dispatch so as to ensure their flawlessness.Range : ½" NB TO 24" NB IN SCH 5, 10, 20, 40, STD, 60, 80, XS, 100, 120, 140, 160 & XXS as Per NACE MR 01 75Type : SEAMLESS / ERW / WELDED/ FABRICATEDForm : Round, Square, Rectangular, Hydraulic, ETC.Length : Single Random, Double Random & Cut LengthEnd : Plain End, Bevelled End, ThreadedStandard : ASTM / ASME SA 312 / SA 358 CL 1, CL 2 & CL 3Grade : 304 , 304L , 304H, 309S ,309H , 310S, 310H , 316 , 316L, 316H , 316Ti , 317 , 317L , 321 , 321H , 347 , 347 H , 904L
Supplier : Renine Metalloys MUMBAI
Posted On :11 months ago


Unior hand tools is the world’s leading supplier of insulated hand tools and automotive tools providing superior quality hand tools. Unior hand tools includes wrenches, sockets, plier, Insulated tools, plumbing tools,shears,screwdrivers,pullers,hammers,punches,chisels,workshop equipment, measuring tools, tools for electronic equipment, automotive tools, vices, clamps, saws, files, wheels, levers, utility knife, tool sets. Unior is a European tools manufacturer with headquarters in Slovenia. Adex International is the premier supplier of Unior hand tools in the UAE with operations in all emirates like Dubai, Abu Dhabi , Sharjah, Ajman, Alain, Umm Al Quwain, Ras Al Khaimah. All the hand tools are manufactured with the best quality raw materials so as to adhere to strict safety standards  Open end wrenchCombination wrenchRing wrenchRatchet wrenchSlogging wrenchHook wrenchSocket wrenchTubular wrenchInbus wrenchChain wrenchSocket setImpact socketCombination plierDiagonal cutterEnd cutterFlat nose plierRound nose plierWater pump and double groove joint plierCrimping plierRing terminalLock ring plierCarpenter and tower pincerGrip plierTile pincerPunch plierInsulated open end wrenchInsulated ring wrenchInsulated socket wrenchInsulated inbus wrenchInsulated socketInsulated torque wrenchInsulated combination plierInsulated water pump plierInsulated diagonal and end cutterInsulated flat and round plierInsulated stripperInsulated cable shearInsulated flat screwdriverInsulated crosstip screwdriverInsulated inbus screwdriverInsulated screwdriver with TX profileInsulated socket screwdriverInsulated voltage testerInsulated cutterInsulated sawInsulated tweezersInsulated tools setWater pump plierPipe wrenchBending toolsCutting toolsTest pumpChain wrenchYoke viceThreestandTin snipLever tin snipNibblerSteel wire cutterPvc pipe cutterCable shearWire rope plier plierThreaded rod cutterBolt cutterPruning shearsScrewdriverMagnetizerRatchet handleBladesBits2 leg puller3 leg puller5 leg pullers and extractorsSeparatorsHomo kinetic pullers for carsLock smiths hammerSledgehammerClub hammerBumping hammerPunchesChiselsWork benchesTools chestToolboxTools cabinetsMetal standsPlastic tool boxTools trolleyToolbagTorque wrenchDigital vernierTorque multiplierMeasuring tapeSpirit levelMason profilesScriberFlat ruleplumb bobplierscrewdrivercar maintenance toolgrip hose clampcollar plierslotholder plierquick couplerplier for fuel pipespick up toolspring clip pliermagnetic trayauto inspection kitclaw pick up tooloil filter wrenchadjustable oil filter wrenchstrap wrenchbody repair kitWindscreen suction lifterHub and wheel drum pullerWheel balancing plierWire brushHandbrake wire plierWheel nut wrenchCar light testertiming pullery pullerbicycle repair toolsbike toolsvicesclampssawsfilesraspsscraperscrew extractorcutting wheelgrinding wheellevergaugesriverteraxetweezersoil cangrease gun     UNIOR TOOLS UNIOR TOOLS  UAEUNIOR TOOLS SUPPLIERUNIOR UAEUNIOR OMANUNIOR SAUDI ARABIAUNIOR BAHRAINUNIOR QATAR UNIOR DUBAIUNIOR SHARJAHUNIOR ABUDHABIUNIOR WHOLESALERUNIOR MAIN DEALERWHERE TO BUY UNIOR TOOLS IN UAE  
Supplier : ADEX 0558763747/0555775434 phiju@adexuae.com /sales@adexuae.com/info@adexuae.com DUBAI
Posted On :11 months ago

Carbon Steel Forged Fitting

Carbon Steel Forged Fitting are suitable to be used in mechanical, automobile, engineering, construction and other allied industries to provide to various applications. These products are available in various sizes, shapes and design as per the clients’ requirements. We fabricate these fittings using quality materials in accordance with the quality standards. Our clients can avail from us these products at most reasonable prices.Sr. No.MaterialSizeClassSpecificationItem1Forged Carbon Steel15 NBTo100 NB30006000&9000 LBSA-105,ANSI B16.11S/W & SCRD(As per Gauge)(NPT / BSP / BSPT)Elbow - 90o & 45oTee - Equal & ReducingUnionCrossCoupling – Full, Half &Quick ReleaseSocket (Reducing)CAPPlug-Hex & Square,Nipples (Hex/Reducing)BushingSokolet, Weldolet, Thredolet,Elbolet & Nipolet
Posted On :12 months ago


Ramming Mass with Boric acid & with out. Any size can be supplied up on customer Spec. FOR MORE DETAILS PLEASE CONTACTEMAIL-sales@plastochemfzc.comMOBILE-0529934411
Supplier : Plastochem FZE AJMAN
Posted On :12 months ago


Pioneers in the industry, we offer Single Stage Rotary Vane Pumps, Rotary Vane Vacuum Pressure Pumps, Rotary Vane Vacuum Pumps, Two Stage Rotary Vane Vacuum Pump, Sliding Vane Pumps and Double Stage Rotary Vane Vacuum Pumps from India.Being one of the preferred choices of our customers, we are involved in manufacturing and supplying Single Stage Rotary Vane Pumps that can be obtained at reasonable prices. Vastly used in multiple industries for major vacuum
Supplier : Pfeiffer Vacuum AJMAN
Posted On :12 months ago

Weishaupt Burners

Posted On :12 months ago


Posted On :12 months ago

Bicon Cable Ties Suppliers

02-6345 894 , 050 460 81 57roshan@electromaxuae.comBicon Cable Ties Suppliers 
Supplier : Electromax Technical Trading LLC ABU DHABI
Posted On :2 years ago

BONFIGLIOLI 700CT - Track drive with Bonfiglioli a

BONFIGLIOLI 700CT - Track drive with Bonfiglioli aCALL : 00971558866913Torque Range 3500 ... 12500 Nm Machine weight 2.5 up 9 Ton Gear Ratios 15 ... 53 Key Features Rotating output flange with large PCD suitable for sprocket Rugged design High torque capacity High load capacity Mechanical lifetime seals Compact design Hydraulic motors Bonfiglioli Trasmital hydraulic motors, fixed OR dual displacement, with flushing valve circuit, suitable for closed loop applications. Motor options Speed sensor mounting. Brake Hydraulically released spring applied parking brake, with external indipendent port.
Posted On :2 years ago

knife of Meat Mincer in uae

We are Dealing and Selling All kinds Of Kitchen Equipment,Spare Parts and Accessories. For more info. please contact usMob# 055 5970441 Whatsapp#050 7876365Email: Sales@viaemex.comWebsite: www.viaemex.comWE ARE LOOKING FORWARD TO SERVE YOUR NEEDS SOON..
Supplier : Viaemex SHARJAH
Posted On :2 years ago

Neat patch NP2

NEAT PATCH NP2 IN UAE , MIDDILEEAST .   BEST SOLUTION FOR CABLING TERMINATION .neat patch in uae .neat patch in dubai neat patch reseller in uae neat patch distributor in uae Contact: +971-4255 6776/6365, Mob: 0526908475Email: sarath@avcom.ae / info@avcom.aeWebsite: www.avcom.ae
Posted On :2 years ago

Scanning Document Service in UAE

Scanned document service in Sharjah
Supplier : Inbox FZC SHARJAH
Posted On :2 years ago

Wood Cutting Machine Supplier in UAE

Wood Cutting Machine Supplier in Abudhabi, Wood Cutting Machine Supplier in Ajman, Wood Cutting Machine Supplier in Dubai, Wood Cutting Machine Supplier in Sharjah, Wood Cutting Machine Supplier in Ras Al Khaimah
Supplier : Spark Technical Supplies FZE SHARJAH
Posted On :2 years ago

traffolyte tag sharjah

0502039351 / 0556463110 / 065333101izrauae@gmail.com.industrial area 4 / al wahda / sharjahENGRAVING & ETCHING ON SS / MS / ALUMINIUM / BRASS / COPPER
Posted On :2 years ago


Parasmani Engineers (India) is a dynamic group, which was established over a decade ago to cater to growing demands of ASME B16.5 Class 150 Blind Flanges standards in Slip On Flanges, Weld Neck Flanges, Blind Flanges in all materials like Stainless Steel , Carbon Steel & High Nickel Alloys. We Manufacture, Export and Supply Flanges which meets with national and international quality standards and producing base which owns equipments conforming to international technical level and is well equipped with a whole set of advanced plasma refining equipments.We export our high quality ASME B16.5 Class 150 Blind flanges to Kuwait, Egypt and Qatar.ASME B16.5 Class 150 Blind Flanges SpecificationsDimensions Of ASME B16.5 Class 150 Blind Flanges Materials of ASME B16.5 Class 150 Blind Flanges  Packaging of ASME B16.5 Class 150 Blind Flanges SPECIFICATIONS OF ASME B16.5 CLASS 150 BLIND FLANGESStainless Steel ANSI B16.5 Class 150 Blind Flanges   Carbon Steel ANSI B16.5 Class 150 Blind Flanges   Nickel Alloys ANSI B16.5 Class 150 Blind Flanges Size: 1/2" (DN15) ~ 60" (DN1500)Pressure: Class 150, Class 300, Class 400, Class 600, Class 900, Class1500, Class 2500ASME B16.5 Class 150 Blind Flanges Type: Weld Neck Flanges, Blind Flanges and Slip On FlangesFace Type: Flat Face (FF), Raise Face (RF), Ring Joint (RJT)Coating: Anti-rust Paint, Oil Black Paint, Yellow Transparent, Zinc Plated, Cold and Hot Dip GalvanizedDimension:ANSI/ASME B16.5, ANSI/ASME B16.47 Series A (MSS SP-44), ANSI/ASME B16.47 Series B (API 605),ANSI/ASME B16.36, ANSI/ASME B16.48 (API 590) ExecutionASMEWelding Neck FlangesB 16.5 / 16:47Blind FlangesB 16.5 / 16:47Slip On FlangesB 16.5Lap Joint FlangesB 16.5Threaded FlangesB 16.5Socket Welding FlangesB 16.5Long Welding Neck FlangesB 16.5Orifice FlangesB 16:36Spectacle BlindB 16:38Flanges to BS 3293 / API 6A, as well as drawing 
Posted On :2 years ago


Universal BeamsClick to view the size rangeUniversal ColumnsClick to view the size rangeEuropean Specification Beams with Parallel FlangesClick to view the size rangeMS Chequered SheetsClick to view the size rangeChannelsClick to view the size rangeHot Rolled Sheets and PlatesClick to view the size rangeEuropean Standard Channels (UPN)Click to view the size rangeParallel Flange Channels (PFC)Click to view the size rangeEqual AnglesClick to view the size rangeUnequal AnglesClick to view the size rangeMild Steel Flats BarsClick to view the size rangeMild Steel Round & Square BarsClick to view the size rangeHollow SectionsClick to view the size rangeGratingClick to view the size rangeJIS BeamsClick to view the size range
Supplier : Al Ras Building Material L.L.C. DUBAI
Posted On :2 years ago


Supplier : T.T.K Insulation Contracting LLC DUBAI
Posted On :2 years ago

Hastelloy C276 Socket Weld Flange

Aiming to satisfy our clients, we are engaged in offering a premium quality Hastelloy C276 Socket Weld Flange. This socket weld flange is manufactured by top grade basic material & leading techniques in fulfillment with the set standards. Our offered socket weld flange is widely acclaimed in different industrial sectors for its corrosion resistance & superior finish. As well, offered socket weld flange can be customized in accordance with the market preferences in a promised time frame.Features:Compact built offers easy installationDelivers exceptional durability and support in fitting High strengthOther Details:Serration as per customers’ requirements.Dimensionally 100% OKUltrasonic Test 100% OKDye Penetrant Test 100% OKIGC Test 100% OKHardness 100% OKChemical and Physically 100% Specifications:Material SpecificationInconel ASME SB564, ASTM B564, ASME SB 865, ASME SB 637, ASME SB 462, ASME SB381, ASME SB 493, ASTM B 865, ASTM B 637, ASTM B 462, ASTM B381, ASTM B 493Material GradesAlloy 200, Nickel 200, N02200, Alloy 201, Nickel 201, N02201, Alloy 400, Monel 400, N04400, Alloy K-500, Monel K-500, N05500, Alloy 600, Inconel 600, N06600, Alloy 601, Inconel 601, N06601, Alloy 625, Inconel 625, N06625, Alloy 718, Inconel 718, N07718, Alloy 800, Incoloy 800, N08800, Alloy 800H, Incoloy 800H, N08810, Alloy 800HT, Incoloy 800HT, N08811, Alloy 825, Incoloy 825, N08825, Alloy C-276, Hastelloy C-276, N10276, Alloy C-4, Hastelloy C-4, N06455, Alloy C-22, Hastelloy C-22, N06022, Alloy B-2, Hastelloy B-2, N10665, Alloy 20, Carpenter 20Cb3, N08020Dimension StandardsASME / ANSI B16.5Weld Neck Flanges, Slip On Flanges, Blind Flanges, Socket Weld Flanges, Screwed Flanges, Orifice Flanges, Lap Join Flanges, Long Weld Neck Flanges, 150 #, 300 #, 600 #, 900 #, 2500 #ASME B16.47/B16.48Spectacle Blinds, Spades, Spacers, Weld Neck Flanges, Blind Flanges, Orifice FlangesDIN Standard FlangesEN 1092-1, Type 1, Type 2, Type 11, Type 13, Type 5, PN6, PN10, PN16, PN25, PN40UNI NORM FlangesUNI 2276, 2277, 2278, 6089, 6090, 2280, 2281, 2282, 2283, 2284, 2253, 2254, 6092, 6093DIN NORM FlangesDIN 2573, 2576, 2642, 2631, 2632, 2633, 2634, 2635, 2565, 2566, 2527CertificationEN 10204 3.1 / 3.2Seamac takes precise care about our packing as we make sure that our goods reach our client in the same position in which it was dispatched from our facility.
Supplier : Seamac Piping Solutions Inc. MUMBAI
Posted On :2 years ago


IV SUBMINISTRATION BAG WITH AIR CHAMBERWe have chosen a tear proof material that is robust and easily washed; a net in polypropylene to hold the infusion bag, indestructible but allowing the solution contained in the bag itself to breathe; an elastic air chamber of good quality. It can be used together with the Warmpak. It holds bags of 500 and 1000 cc.
Supplier : Arasca Medical Equipment Trading LLC DUBAI
Posted On :2 years ago

Rental floor cleaning machine in dubai

Champ 3329/3529Contact: 056-8967001/04-3373435The little ride-on automatic scrubber with 'oomph' just got bigger. For those who love the performance characteristics of the Champ 2929 but need to clean larger floors, the Champ 3329 and Champ 3529 are the perfect ride-on scrubbers.33-in/84-cm (Champ 3329) or 35-in/89-cm (Champ 3529) scrub path with 46-in/117-cm curved Linatex blade squeegee29-gal/110-l solution tank and oversized 32-gal/121-l recovery tank1-HP drive motor with three forward speeds2.5-HP brush motor, adjustable 220-300 RPM brush speedSix 6V, 350 AH batteriesOptions incude lights and bumper kitContact: 056-8967001/04-3373435
Supplier : Al Sayegh Trading Co LLC... DUBAI
Posted On :2 years ago

Fuel Meter

Fuel Meter
Supplier : Clear Way Building Materials Trading ABU DHABI
Posted On :2 years ago


Commercial Plywood 18mm 4'x8' ,12mm 4'x8' , 9mm 4'x8' ,5.2mm 4'x8', 3.6mm 4'x8' 
Posted On :2 years ago


Supplier : Emirates Jo Trading Co. LLC SHARJAH
Posted On :2 years ago

SEAL SUPPLIERS IN Dubai, Sharjah, Abu Dhabi, UAE

SEAL SUPPLIERS IN Dubai, Sharjah, Abu Dhabi, UAE
Supplier : Multiflow Hydraulic Equipment Maintenance AJMAN
Posted On :2 years ago

Absolute_Black Granite Suppliers In Uae

Absolute_Black Granite Suppliers In Uae06 5354704 /00971 502104230info@sabtagranite.com
Supplier : Sabta Granite & Marble Trading SHARJAH
Posted On :2 years ago