Welcome to Dubai Yellow Pages Online
Global Site for local Search
Get it on Google Play
Elite Products in Industrial Supplies Market of Dubai

Price label gun supplier in UAE

All types of pricing label gun and all leading brands Brands: - Evo, Meto, Monarch, Santo, Prix, Opentex, etc.
Supplier : WeSupply General Trading FZC AJMAN
Posted On :3 weeks ago


GLEITMO HMP 9020 K GLEITMO HMP 9020 K is suitable for the lubrication of bulk parts like stud-bolts, nuts, sheet metal screws and tension springs. For hot galvanized high-tensile fasteners, the standard for lubricant requirements DIN EN 14399 is fulfilled by using of GLEITMO HMP 9020 K. GLEITMO HMP 9020 K is an advance development of GLEITMO HMP 9020 with enhanced corrosion protection properties.
Posted On :2 months ago


Single plastic toiletsInbuilt Water tank and Holding tankFoot/Hand pump flushing
Supplier : Kazema Portable Toilets AJMAN
Posted On :3 months ago

Rubbish Chute

Construction Garbage ChuteIdeal for the safe disposal of rubble from high levels, this chute is quickly and easily
Supplier : Reunion Safety Equipment Trading ABU DHABI
Posted On :3 months ago

Bucket Elevator Chains In Oman

We are a leading manufacturer and exporter of Bucket Elevator Chains.
Supplier : B. V. Transmission Industries MUMBAI
Posted On :3 months ago


Supplier : Gulf Safety Electromechanical (info@gulfsafetyuae.com) ABU DHABI
Posted On :4 months ago

Bio Hazard Bag Yellow 45X60

Bio Hazard Bag Yellow 45X60
Posted On :4 months ago

Scrap metals Buyer in UAE Sharjah.

We  are ready to immediately BUY  METALS so contact us 0564113933/Watsapp 0522118676.
Supplier : Al Rukn Metals SHARJAH
Posted On :4 months ago


Posted On :4 months ago


We have highly qualified & skilled team to do insulation & cladding jobs. We also stock insulation materials such as Ceramic fibre blankets / accessories for insulation
Posted On :5 months ago

Acrylic Hand Rail supplier in Dubai

  For More Details :- Krunal Patel M           + 971509222146 E           krunal@sabinplastic.com
Supplier : Sabin Plastic Industries LLC SHARJAH
Posted On :5 months ago


Butyl Corrosion Tape used as an anti-corrosive coating, waterproofing, moisture/vapour sealing system in the pipelines, building and construction industriesButyl Sealant Tapes
Supplier : AL SAD Importing & Trading Est. (AL SAD) ABU DHABI
Posted On :5 months ago


Posted On :5 months ago


GOLDEN LIGHTS TRADING LLC POST BOX # 27529, DUBAI, UAE Tel: +971 4 2257673 Fax: +971 4 2257981 Email: sheerazi@eim.ae Email: info@goldenlightuae.com URL: www.goldenlightuae.com
Posted On :5 months ago

Dixell Controllers

Posted On :6 months ago


With the help of our skilled workforce and manufacturing unit, we are engrossed in offering a huge range of L Bolt. The offered bolt is fabricated from top quality material and latest techniques at our well equipped manufacturing unit. In addition to this, entire range of offered bolts undergoes series of tests under the strict vigilance of our quality experts. 
Supplier : kalpataru piping solutions MUMBAI
Posted On :6 months ago

22214 E

BBS Bearings Spherical feature the industry's highest load rating: a full 18% higher than a standard spherical roller bearing. This level of quality means at least a 75% extension of service life. The performance of these spherical is achieved through the use of very high quality raw materials and optimized rolling element geometry.The unique design also leads to:. Reduced friction torque (as much as 30% less), offering lower operating temperature, with lower power and lubricant consumption. Appreciably increased operating speed, allowing an extended scope of applications. High temperature capacity of up to 200o C (392oF) for metallic cage bearings. Dimensional stability is ensured by a specific heat treatment. A +/- 0.5o misalignment capability, without reducing the load capacity, and up to 1o 30' in case of low loads.
Posted On :6 months ago

Industrial Washing machines

mplements and modernizes complete systems. We focus on resource conserving consumption and environmentally compatible water treatment: integrated recovery systems ensure that you save energy, water and chemicals. First time in India, we have designed, manufactured and have commissioned of modular wet treatment systems. It stands for perfect corrosion protection of Metal parts, body and for its quality and value retention.Throughout the ent i re c leaning, pretreatment and ED process we make sure that all components interact perfectly. With standardized components and parts - designed, integrated and implemented by smooth interfaces and process sequences are assured
Posted On :6 months ago

Machine Nuts

Price:•All Forged Fittings From 20/- To 10000/- Per No Designed for a broad set of application, we offer you a range of Machine Nuts(Lateral Tee ). Our comprehensive line of standard precision-engineered nuts is superior to cold formed and punched nuts. These ready to use machine nuts are reliable in nature and also have a long serving life. Lauded for our quality range, we assure the satisfaction of our customers.Features:Corrosion resistanceLightweightGood quality
Posted On :6 months ago

Bopp Clear Tape supplier in UAE

roduct Benefits Carton Sealing Anti-aging, adhesive for long Waterproof Single Sided Strapping and bundling High holding adhesion, strong anti-Alice Easy tear and thin strong filming Anti freezing, environment protection, stable quality Durable viscosity, no discoloration Tensile strength, practical , smooth Model Size Micron Core Size Pack S-1012 2/1”× 40 / 60/100 yds 50 /45 3 mm 1×36 Long Description Made of Acrylic coated on BOPP film and high adhesive, it printable and excellent for water resistance and mostly getting use for carton sealing. Available in different yard and micron. Resistance temperature 70 o C, holding adhesion ≥ 12hrs , adhesive Acrylic emulsion, Widely used in packaging, bundling, fixed operations. Stored in a clean dry warehouse, temperature 5 ℃ -30 ℃, storage period of one year, avoid to store & transport together with organic solvents sharp objects, no rolling, tossing.
Posted On :6 months ago


Diesel Power Plant Hire from 1 MW to 100 MW Temporary Power from 1 MW to 100 MW Solar Hybrid Rental Power plantsSupply of Diesel Generator on Hire including: 50 kVA Diesel Generator80 kVA Diesel Generator100 KVA Diesel Generator125 kVA Diesel Generator250 kVA Diesel Generator300 kVA Diesel Generator360 kVA Diesel Generator500 KVA Diesel Generator800 kVA Diesel Generator1000 KVA Diesel Generator1250 KVA Diesel GeneratorGas generators Hire
Supplier : SES Smart Energy Solutions Fzco DUBAI
Posted On :7 months ago

Refrigerated Truck,Chiller van,Freezer pallet pickup,Reefer Trailer,Catering transport rental UAE

Refrigerated Truck Transport, Chiller Van, Freezer Pickup and Catering Services, Reefer Trailers Rental, Logistics and Road Freight services, Delivery services Dubai UAE Fresh Freights Handling frozen food with care Fresh Freight Refrigerated /Chiller /Freezer Transport Services Dubai, Abu Dhabi UAE Fresh Freight Refrigerated Transport is a reputed Refrigerated land transporting company since 2009, located Al Quoz Industrial area 4 Dubai. We have a good exposure in the field of trucking, Freezer Truck, Chiller van, refrigerated truck, Freezer Pick up, Reefer Trailers, Catering Services to GCC and inside UAE, Dubai and Abu Dhabi.   Our trucking services included:                                                                  ·       Chiller Van 1 ton and Refrigerated truck 3/4/7/10 ton truck/pickups for local & GCC trips ·       Reefer trailers (12.5 & 13.6 Mtr Length / 2.7 Mtr Width) i.e. 40 – 45 feet trailers ·       Open trailers: Flat and Box trailer (12 & 15 Mtr Trailers) i.e. 40 - 50' trailers ·       Closed trailers: Reefer and curtain trailers ·       Low bed trailers (30 - 100 Ton capacity) ·       car recovery and car carriers ·       Pickups (3, 7, 10 ton) ·       Catering and Event transportation providers in Abu Dhabi and Dubai ·       Logistics and road freight ·       Medical Transportation under temperature control vehicles We will carry your head ache by providing excellent services like on time place the trailers, any time call answer from operation and daily track record by mail to your desk and more. We can provide cash and credit business with reasonable rates.   Contact: Mr. Taj Afridi (Business development executive)  Mob #: 050-8163228 Email: hire@freshfreights.com / info@freshfreights.com    Please note that if you have any requirements please call or mail to us with following details: Place of loading and destination Description of materials Weight and dimension of cargo Palletized or Not. Type of truck and no. of requirements Date of loading Final destination clearances Hope the best   Watch us on: http://www.youtube.com/watch?v=3s6GtAPTl1Q We are committed to provide professional services, we are a call away. Daily Basis Rental Monthly Basis Yearly Basis   Contact Us: We work based on your quotation, please contact us on the following numbers: Mob: 055-8413124 Mob: 050-8163228 E-mail: hire@freshfreights.com/info@freshfreights.com Web: http://www.freshfreights.com
Supplier : Fresh Freights refrigerated transport L.L.C DUBAI
Posted On :7 months ago


Warehouse management operations are the core of any product and service oriented company. Managing the flow of accurate inventory data is proving to be a costly challenge for companies faced with cumbersome, error-prone, manual-based processes that lead to higher operation costs, excess inventory and inefficient use of storage spaceDatametric warehouse management system automates manual based processes from purchasing to shipping and delivery to customers, having complete visibility and control in a mouse click away.Warehouse management solutions has been deployed to customers across a variety of industries including logistics service, wholesale, distribution, manufacturing and automotive among others.From inventory control, shipping and receiving, to order fulfillment, a WMS is vital to improving the efficiency of a company’s warehouse operations. Datametric, offers WMS software packages that can be customized to fit the needs of companies of any size. By combining a WMS system with a wireless network, mobile computers, radio frequency identification (RFID) technology, Datametric can help fully extend your enterprise to the mobile worker, while increasing operational efficiencies and enhancing your customer service.ReceivingGain insights into shipments that have been delivered, but that are not yet at their final location. Make sure items at low stock levels are staged and put away first, reducing the impact of out-of-stocks and inefficient fulfillment processes.ReceivingGain insights into shipments that have been delivered, but that are not yet at their final location. Make sure items at low stock levels are staged and put away first, reducing the impact of out-of-stocks and inefficient fulfillment processes.Put-AwayKnow the location of all inventory on your shelves. Route your workers to the right location, set up their picks in the proper order to minimize travel time, and increase the number of orders they can pick each dayPickingImprove error-proofing and productivity in the picking process. Workers receive their picks on a mobile device that routes them to the proper location. Scanning items when you pick them verifies that the right item at the right quantity is picked.Packing/ PalletizingEnsure the accuracy of each order that is picked and reduce material costs by determining the right sized shipping carton.Shipping/DispatchSee that each order is properly packaged and shipped to the right destination and delivered on the right date.Physical Stock TakingThrough Mobile Computer Inventory count can be done by scanning each item barcodes. At the end of operation system generates material variance report location wise, Item wise.Reporting ManagementThe Warehouse Inventory Tracking System is designed to provide a wide range of useful enquiries and reports based on specific data analysis including current stock, item movement, etc.Wi-Fi and Barcode SystemThe Warehouse Inventory Tracking System is designed to provide a wide range of useful enquiries and reports based on specific data analysis including current stock, item movement, etc.
Supplier : Datametric Technologies LLC DUBAI
Posted On :8 months ago

Aluminium louver works in sharjah

Dear Customers,         APM shades specialized to make car park shade, sun shade, tents, canopies,awning, majlis tents, Aluminium Doors, Aluminium Windows, Aluminium Partition, Gypsum partition, Frame-less Glass Partition and Aluminium Louver works,Please visit our website for more detail :apmshades.wixsite.com/apmshades orPlease Call our sales HeadMr. Murugan AP,apm shades - FZE,Tel: +971 6 766 2614Mobile:​ +971 55 1668143Email: murugan@apmshade.com
Posted On :8 months ago


Posted On :8 months ago


Smart Point Technical Services LLC trade accredited carpenters are on standby to handle everything from emergencies such as break-ins to full kitchen installations. Every job our expert carpenters in Dubai do comes complete with a minimum six month guarantee, so you know you're getting the highest quality of work every single time.
Supplier : Smart Point Technical Services LLC DUBAI
Posted On :8 months ago


Supplier : Super Perkins Facilities Management & Services L DUBAI
Posted On :8 months ago

Roots Multiclean Uae

Posted On :9 months ago

Butt Weld Fittings

We are offering wide range of butt weld fittings like:-Stainless Steel Butt Weld Fittings-Hastelloy Butt Weld Fittings-Alloy-20 Butt Weld Fittings-Duplex Butt Weld Fittings-Alloy Steel Butt Weld Fittings.*Features:-Made of high grade raw material-Easy fitting-Long lasting-Corrosion resistance-Dimensionally accurate-Reasonable price.*Delivery: As per the client's schedule.*Customization: Deliver customized products.*Packaging: Durable and safe packaging.*Clients: Spread all across the nation.
Posted On :9 months ago

Pipe Wrench

Prayas Metal India Pvt. Ltd. has garnered immense reputation as a Stockist & Exporter of Pipe Wrench. These Pipe Wrenches are used for turning soft iron pipes and fittings with a rounded surface. In general words, these Pipe Wrenches are used to tighten and loose pipe joints. We offer these Pipe Wrenches at very affordable prices.
Posted On :9 months ago

traffolyte labels suppliers

Posted On :9 months ago

Butt Weld Fittings

We are the stalwarts in the domain of manufacturing, supplying, distributing, importing and exporting a wide gamut of SS 904l Butt Weld Fittings. Manufactured using finest quality stainless steel, our range is applauded for its easy fitting, dimensional accuracy, corrosion resistance and fine finishing. Moreover, we offer these fittings in various specifications at nominal prices.Size: 1/8"NB to 48"NB inSchedule: SCH20, SCH30, SCH40, STD, SCH80, XS, SCH60, SCH80, SCH120, SCH140, SCH160, XXSType: Seamless / ERW / Welded / FabricatedMaterials:Stainless Steel 904L Buttweld Fittings – SS 904L Buttweld FittingsASTM A403 WP Gr. 904L
Supplier : Renine Metalloys MUMBAI
Posted On :10 months ago

Labelling Machine

Labelling Machine in UAE
Supplier : Total Packaging Solutions FZC SHARJAH
Posted On :10 months ago


CordlessDrills & Fastening toolsHammers & Diamond cutting toolsDust ManagementGrinders & Metalworking toolsWoodworking toolsSpecialty ToolsSaws
Supplier : Sadeem Building Material Trading Co DUBAI
Posted On :10 months ago


Unior hand tools is the world’s leading supplier of insulated hand tools and automotive tools providing superior quality hand tools. Unior hand tools includes wrenches, sockets, plier, Insulated tools, plumbing tools,shears,screwdrivers,pullers,hammers,punches,chisels,workshop equipment, measuring tools, tools for electronic equipment, automotive tools, vices, clamps, saws, files, wheels, levers, utility knife, tool sets. Unior is a European tools manufacturer with headquarters in Slovenia. Adex International is the premier supplier of Unior hand tools in the UAE with operations in all emirates like Dubai, Abu Dhabi , Sharjah, Ajman, Alain, Umm Al Quwain, Ras Al Khaimah. All the hand tools are manufactured with the best quality raw materials so as to adhere to strict safety standards  Open end wrenchCombination wrenchRing wrenchRatchet wrenchSlogging wrenchHook wrenchSocket wrenchTubular wrenchInbus wrenchChain wrenchSocket setImpact socketCombination plierDiagonal cutterEnd cutterFlat nose plierRound nose plierWater pump and double groove joint plierCrimping plierRing terminalLock ring plierCarpenter and tower pincerGrip plierTile pincerPunch plierInsulated open end wrenchInsulated ring wrenchInsulated socket wrenchInsulated inbus wrenchInsulated socketInsulated torque wrenchInsulated combination plierInsulated water pump plierInsulated diagonal and end cutterInsulated flat and round plierInsulated stripperInsulated cable shearInsulated flat screwdriverInsulated crosstip screwdriverInsulated inbus screwdriverInsulated screwdriver with TX profileInsulated socket screwdriverInsulated voltage testerInsulated cutterInsulated sawInsulated tweezersInsulated tools setWater pump plierPipe wrenchBending toolsCutting toolsTest pumpChain wrenchYoke viceThreestandTin snipLever tin snipNibblerSteel wire cutterPvc pipe cutterCable shearWire rope plier plierThreaded rod cutterBolt cutterPruning shearsScrewdriverMagnetizerRatchet handleBladesBits2 leg puller3 leg puller5 leg pullers and extractorsSeparatorsHomo kinetic pullers for carsLock smiths hammerSledgehammerClub hammerBumping hammerPunchesChiselsWork benchesTools chestToolboxTools cabinetsMetal standsPlastic tool boxTools trolleyToolbagTorque wrenchDigital vernierTorque multiplierMeasuring tapeSpirit levelMason profilesScriberFlat ruleplumb bobplierscrewdrivercar maintenance toolgrip hose clampcollar plierslotholder plierquick couplerplier for fuel pipespick up toolspring clip pliermagnetic trayauto inspection kitclaw pick up tooloil filter wrenchadjustable oil filter wrenchstrap wrenchbody repair kitWindscreen suction lifterHub and wheel drum pullerWheel balancing plierWire brushHandbrake wire plierWheel nut wrenchCar light testertiming pullery pullerbicycle repair toolsbike toolsvicesclampssawsfilesraspsscraperscrew extractorcutting wheelgrinding wheellevergaugesriverteraxetweezersoil cangrease gun     UNIOR TOOLS UNIOR TOOLS  UAEUNIOR TOOLS SUPPLIERUNIOR UAEUNIOR OMANUNIOR SAUDI ARABIAUNIOR BAHRAINUNIOR QATAR UNIOR DUBAIUNIOR SHARJAHUNIOR ABUDHABIUNIOR WHOLESALERUNIOR MAIN DEALERWHERE TO BUY UNIOR TOOLS IN UAE  
Supplier : ADEX INTL/ 0558763747/ phiju@adexuae.com / info@adexuae.com DUBAI
Posted On :10 months ago


EXCEL METAL & ENGG INDUSTRIES Fittings are designed for Instrumentation and Process Control System Tubing, Double Ferrule Compression Tube Fittings are provided for leak proof, torque free seal at all tubing connections, and eliminates costly hazardous leaks in process and instrumentation tubing lines, EXCEL METAL & ENGG INDUSTRIES . also manufacture Single Compression Type Fittings.EXCEL METAL & ENGG INDUSTRIES . offers Single Ferrule, Double Ferrule type Male / Female Connectors, Unions, Bulk Head Unions, Cross, Elbow, Tee, Tube Plug and Tube Cap in various sizes.M.O.C: SS304, SS316, Carbon Steel , Brass , nickel alloy , etcSizes: As per customer’s RequirementEnd Connections: NPT / BSP / BSPT / UNFRating: 1500, 3000, 6000, 10000 PSI.
Posted On :10 months ago


Supplier : Bright Future Int. Sanitaryware Trading SHARJAH
Posted On :10 months ago


www.bppcouae.com  AL BARSHA PRECISION MOLDING DIES IND. L.L.C  For industries related to Oil & Gas field, Fabrication etc. we can do the CNC job work  as per customer’s requirement. As a Mould Making Company we can also design and manufacture Injection Mould according to your requirement.
Posted On :11 months ago

Hydraulic Diaphragm Pump

Our company is one of the preferred choices of our customers for proffering oil-free Hydraulic Diaphragm Pump. Manufactured as per the set industry norms, these efficient pumps are widely used in applications, where a dry and oil-free vacuum is required. These pumps are known for their excellent speed.  Features: Longer service life Portable Less energy consumed Specifications: Compact diaphragm pump with a pumping speed: Upto 0.7 m3/hFor mains voltage: 90-127 V, 50 Hz, respectively 187-265 V, 60 HzIdeal for applications where a dry and oil-free vacuum is required2 = 2-stage diaphragm pump for easy applications 4 = 4-stage diaphragm pump for best ultimate pressureAdditional Information:Item Code: MVP0152
Supplier : Pfeiffer Vacuum AJMAN
Posted On :11 months ago


Our wide range of tapes are available to cater for any requirement you may have. Each tape is specifically designed to perform in a specific environment. 
Supplier : Development Generation General Trading DUBAI
Posted On :11 months ago


Aluminum cabin -Aluminum profile ,Aluminum HPL sheet ,Tempered glass  and Silicone Making Cabin with Half glass, Half HPL sheetSingle Door , Double Door Roof with Sheet and Frame 
Supplier : Euro Steel and Aluminium LLC Umm Al Quwain
Posted On :11 months ago

Installation Fastening Fixing Systems: Fischer

For almost 68 years, Fischer has garnered a widespread reputation for designing, engineering and building innovative fixing solutions. Since the company was founded in 1948, it has been driven by a constant will to change and strive for better solutions. Presently with 44 subsidiariesin 33 countries, production locations in seven countries, 4423 employees and with over 1500 industrial property rights internationally has made the fischer group of companies one of the most innovative companies worldwide. Customers who choose fischer get more than just a range of secure fixing products. Our goal is to ensure that we always offer our customers the best solutions with real added value.In addition to innovative and outstanding products, this primarily includes user oriented advice and benefit oriented services. fischer is a leading brand in which engineering experts throughout the world place their trust.
Supplier : Fakhri & Brothers Air Conditioning Trading LLC SHARJAH
Posted On :11 months ago

steel gates by Maxwell Automatic Doors Co LLC Post box 82715 Dubai – UAE Tel: +971 4 2976951 Mobile: +971 50 4405076 Email: Estimation@maxwelldoors.com www.maxwelldoors.com

steel gates in uaesteel gate suppliers in uaesteel gate manufacturerssteel gate workssteel fabricators in uae Maxwell Automatic Doors Co LLC Post box 82715 Dubai – UAE Tel: +971 4 2976951 Mobile: +971 50 4405076 Email: Estimation@maxwelldoors.com www.maxwelldoors.com
Supplier : Maxwell Automatic Doors Co LLC DUBAI
Posted On :11 months ago


Garnet Size 30 -60 mesh20-40 mesh.for sand blasting, etc..FOR MORE DETAILS PLEASE CONTACT;EMAIL : sales@plastochemfzc.comMobile: 0529934411
Supplier : Plastochem FZE AJMAN
Posted On :11 months ago


Stainless Steel Bolts, Alloy Steel Stud Bolts, Monel Eye Bolts, Carbon Steel Hex Head Bolts Suppliers in India. Nickel Alloy J Bolts, Duplex Steel U Bolts Exporter, Inconel Foundation Bolts, SS Structural Bolts Leading Manufacturers. A.B. Stainless Steel is one of the largest exporter, manufacturer and supplier of Bolts in India. Many bolt heads as a supernumerary deadbolt the bolt in place, so that it does not change and an apparatus is just necessary for the nut end. Bolts are as well used as a widespread range of head designs, as do screws. In the meantime, these are being considered to join in by means of the tools that are being used to tighten them. A bolt is a construction of threaded fastener in the company of having an external male thread.These Bolts are consequently very much connected to, and frequently confused by means of, screws. Our Bolts Fastener can be accessible in custom-built length shapes and sizes, and are obtainable at market leading rates. For to meet up the piping requirements of our customers, these fasteners can as well be machined and fabricated. Bolts, Stud Bolts, Hex Head Bolts, U Bolts, J Bolts Specification Specifications : DIN, ASTM, BS and all International Standards Size : M3 - M56 3/6" to 2" Custom Sizes Length : 3 mm to 200 mm Type : Bolts, U- Bolts, J Bolts, Mushroom Head Square Neck Bolts, T-Head Bolts, Eye Bolt, Stud Bolts, Hex Head Bolts, Socket Hexagon Head Screw Anchor Bolt, Foundation Bolts, Structural Bolts. Our Bolts conforms to NACE MR0175/ISO 15156 Bolts Material & Grades Stainless Steel Bolts : AISI 302, 304, 304L,316, 316L, 310, 317, 317L, 321, 347, 410, 420,904L etc. Alloy Steel Bolts : ASTM / ASME A/SA 193 / 194 B 6, B 7/ B 7M, B 16, 2, 2HM, 2H, GR 6, B 7, B 7M Carbon Steel Bolts : ASTM A307, A193 Duplex & Super Duplex Steel Bolts : ASTM / ASME A815 UNS No. S31803, UNS No. S 32205, UNS No. S 31254, UNS No. S 31550, UNS No. S 32750, and UNS No. S 32760 Nickel Alloy Bolts : ASTM / ASME SB 160 / 164 / 425 / 166 / 446 / 574 / 472 UNS 2200 (NICKEL 200) / UNS 2201 (NICKEL 201), UNS 4400 (MONEL 400), UNS 8825 (INCONEL 825), UNS 6600 (INCONEL 600) / UNS 6601 (INCONEL 601), UNS 6625 (INCONEL 625), UNS 10276 (HASTELLOY C 276), UNS 8020 (ALLOY 20 / 20 CB 3) 
Supplier : A B Stainless Steel MUMBAI
Posted On :11 months ago

Inconel 600 Pipe Fittings`

Inconel 600 is a popular alloy used to manufacture Inconel 600 Pipe Fitting. Om tubes is a world renowned manufacturer and exporter of Inconel 600 pipe fitting to buyers worldwide. We offer specific materials like Inconel 600 Pipe Fitting in standardized products like pipe and tube fittings in varying sizes and finishes. Our sales service is the most prodigious and well known in the steel and pipes industry. We specialize in specific requirements of industries in special metals and alloys and deliver it promptly. Om tubes is a large stockiest of Inconel products and owns a mega storage unit of Inconel 600 Pipe Fittings, to meet any urgent requests for same day shipping. Om tubes aim to achieve a 100% customer satisfaction rate. To do so, we lay importance on every stage of purchase, from product enquiry to shipping. Om tubes have an export market in North America, Africa, Eastern Europe, UAE and Middle East countries.
Supplier : Om Tubes & Fitting Industries MUMBAI
Posted On :11 months ago


We have equipment available for any and all types of construction. From general building construction, to heavy utility and highway construction, to residential building and homeowner projects, we have equipment and tools to help you build it to specification, on time, and on budget.Mahmoud 050-7329320 betterway@eim.a
Supplier : Better Way Transport ABU DHABI
Posted On :11 months ago


Posted On :11 months ago

Pipe Warping Tapes

Pipe wrapping tape is made from spvc as the backing material, which are coated with rubber based adhesive. Good resistant to moisture, humidity, corrosion and temperature variations. Widely used in industr to protection of the air pipe, water pipe, oil pipe and steam pipe on the ground or underground from corrosion and abrasion. Supplying embossed film for easy tear and shiny film. Available in variety of widths, lengths and colors to meet your special requirement.Features:Exellent flexibility;Strong tensile strength;Anti-abrasion and anti corrosion;Good resistance to oil, chemical ad moisture;Non-deteriorating;
Posted On :11 months ago

Metal detectable cable ties

EXPRESS COURIER DELIVERY TO ALL GCC COUNTRIES24X7 Customer SupportORDER NOW 00971 56 93 59 589 / info@novagreen.aewww.novagreen.ae
Supplier : Nova Green General Trading LLC AJMAN
Posted On :12 months ago


Posted On :12 months ago

Draper Tools

Supplier : Western Corporation Limited FZE SHARJAH
Posted On :12 months ago


SHELBER is a unique brand that combines the “Best Choice Guaranteed” slogan that we are famous with, one of the main items that we sell is the SHELBER SUPER STONE MASTIC SERIES. Best quality and most competitive price, the SHELBER MASTIC brand comes with the following types and measurements:24kg Solid Cream 20kg Liquid Transparent
Supplier : Streamline Shelber Bldg Mat Trdg LLC DUBAI
Posted On :12 months ago

Fasteners Nuts Bolts Screws

We are offering fasteners, nuts bolts, screws. stainless steel:- astm a 182, a 240 grade:- f 304, 304l, 304h, 316, 316l, 316ti, 310, 310s, 321, 321h, 317, 347, 347hcarbon steel:- astm a 105, astm a 181alloy steel:- astm a 182, gr f1, f11, f22, f5, f9, f91nickel alloys:- monel 400 & 500, inconel 600 & 625, incolloy 800, 825, hastelloy 904copper alloys:- aluminium, copper, brass & gunmetaltypes:- weldneck, slipon, blind, socket weld, lap joint, spectacles, ringjoint, orifcase, long weldneck, deck flange, etc. size:- 18" nb to 48"nb. class:- 150#, 300#,400 #,600#,900#, 1500# & 2500 #. fasteners, bolts, nuts & screws are widely used in building , machinery, traffic, auto, power plant industries.Fasteners Bolts Nuts : Stainless Steel Bolts NutsPlace of Origin : Maharashtra, IndiaThickness : As Per RequiredOuter Diameter : As Per RequiredCertification : ISOStandard : JIS, AISI, ASTM, GB, DIN, EN, Alloy Steel
Posted On :12 months ago


SLIDING SYSTEM HANDLEProduct Code:   SDS 111 A10Contact: Mr. BassamPhone +971 6 5421439Mob : +971 50 3872707
Posted On :2 years ago

Chemical Storage Tank

We are the leading mfg off chemical storage tank from 100ltrs capacity upto 3 lac ltrs capacity in various grades of material ie: ss316/ss304/ ms /cs
Supplier : Ashtavinayaka Overseas MUMBAI
Posted On :2 years ago

Mechanical Seal

Mechanical Seal
Supplier : Clear Way Building Materials Trading ABU DHABI
Posted On :2 years ago


Supplier : Atlas Al Sharq Trading Establishment SHARJAH
Posted On :2 years ago

Butt Weld Fittings

Creating a niche of Butt Weld Fittings such as Stainless Steel Butt Weld Fittings, Alloy Steel Butt Weld Fittings, Carbon Steel Butt Weld Fittings and Stainless Steel Pipe Fittings at its best, with utmost quality. Stainless Steel Butt Weld FittingsAlloy Steel Butt Weld FittingsButt Weld FittingsCarbon Steel Butt Weld FittingsStainless Steel Pipe Fittings
Posted On :2 years ago

Hardware Materials IN UAE

Thomas MathewDucon Building Materials LLC,PO Box:125411,Dubai-UAE.Tel No:04 4541102Fax No:04 4541103Mob No:050 6778440email: thomas@duconllc.com
Supplier : Ducon Building Materials LLC DUBAI
Posted On :2 years ago

Chillers in sharjah

Chillers in sharjah
Supplier : Emirates Jo Trading Co. LLC SHARJAH
Posted On :2 years ago


Supplier : Isotherm Insulations Fze SHARJAH
Posted On :2 years ago

Stainless Steel Nut

Over the years, we have been busy in offering an elite compilation of Stainless Steel Nut that is used in machines. Our offered Stainless Steel Nut has gain wide approval in the souk owing to its qualitative features like durability and cost effectiveness. Furthermore, it is artificial using best quality basic material and higher machines in devotion to the set manufacturing norms. Our important client can avail this Stainless Steel Nut at most competitive price. Grade and Material Used:Grade SS : 304, 304 L, 316, 316 L, 317 L and 904 L Grade High Tensile : 8.8, 10.9, 12.9, 4.6, B 16Material : Titanium, Monal, Inconal, Hastelloy, Copper and AluminumFor Stainless Steel Nut feel free to contact us.
Supplier : Pearl Overseas MUMBAI
Posted On :2 years ago


HYDRAULIC CYLINDER SEAL SUPPLIERS IN Dubai, Sharjah, Abu Dhabi, UAE:Hydraulic Cylinder SealPneumatic Cylinder SealHydraulic Pump SealHydraulic Valve SealMechanical Seal
Supplier : Multiflow Hydraulic Equipment Maintenance AJMAN
Posted On :2 years ago


Posted On :2 years ago

fabrication works

we so all type of steel fabrication works from stair case to mezzanines,plz call 00971555680048
Supplier : Doors & Shade Systems AJMAN
Posted On :2 years ago

Mikasa Tamping Rammer MT-72FW

Mikasa MT-72FW Tamping Rammer is Robin engine gasoline driven, the most efficient, lowest maintenance and productive ideal for the use in confined areas, compacting trenches, backfills and repairing work on asphalt. It is most suitable for compacting cohesive & non-cohesive soil. For more information visit www.almahroos.com 
Supplier : Al Mahroos Trading Est DUBAI
Posted On :2 years ago


Supplier : Muraibit Ship Spare Parts Trading LLC SHARJAH
Posted On :2 years ago

Industrial Cleaning Machines

Walk Behind Scrubber Dryer: Battery Operated HYPER 2250 BT / 50BTSuitable to work for the maintenance and deep cleaning of large areas (up to 2,200 m²).  User friendly control panel: forward speed setting, scrubbing and vacuuming selectors, battery charge indicator, traction direction indicator, key main switch.  Large handle with traction driving lever for forward and backward directions.  Self levelling brush plate. 
Posted On :2 years ago


Posted On :2 years ago


Domestic water chiller for tank coolingIndustrial application for plastic mouldings /  Rubber industriesCHILLER FOR DOMESTIC OR INDUSTRIAL APPLICATION  IN DUBAI, SHARJAH, ABU DHABI, RAS Al KHAIMAH, UAE 
Supplier : Pride Powermech FZE RAS AL KHAIMAH
Posted On :2 years ago

Saudi Abrasives steel shots supplier dubai

Saudi Abrasives steel shots supplier dubaiSteel Shots are spherical in shape, which are produced by the atomization of molten steel, followed by a series of thermal and mechanical treatment in order to attain martensite microstructure. Steel shots are widely used as a media for descaling steel components prior to coating. In this application the media is used almost exclusively in centrifugal wheel airless blasting equipment. It is also used in the foundry casting industry to remove sand from castings after removal from the mould and also for shot peening operations on metal components which are exposed to severe stress in automobile and construction machinery industriesUSES:- Removes sand and other surface contamination from steel and iron casting, cast pipes, malleable fittings copper and aluminium alloy castings and other general foundry products.- Descalling of forged steel products and heat-treated products.- Shot peening for automotive parts, aircraft components, railway casting, all sorts of gears, super hard steel chips, various tools.- Used in airless wheel blast machines to clean foundry castings, surface polishing and shot peening.- Also used in portable trackblast airless wheel blast machines for concrete floor preparation and profiling.- Long lasting and can be recycled around 100 times, making it the most economical and efficient abrasive.Steel shot is a non polluting blast media used extensively in the blast cleaning industry to remove paint, rust, millscale and other surface contaminants from steel, concrete and other surfaces prior to coating. It is also used to remove surface contaminations from casting parts in foundry. The cost effectiveness is incomparable due to its impact resistance qualities, durability and with utmost cleaning capacity.FEATURES:Particle Shape: Rounded abrasive particles produce a peened surface, whereas angular or irregular shaped abrasive particles produced an etched or angular surface profile. Selecting the right particle shape to produce the required profile and texture for the job at hand can impact productivity and performance of the coating applied.Particle Weight : Different metallic abrasives have different mass weights per unit volume and different impact values. For a given impact velocity and particle shape, the weight (mass) of the particle determines the shape and the depth of the profile produced.As steel abrasives have approximately 1-1/2 to 2-1/2 times the density of nonmetallic abrasive, steel abrasives create more impact for a given particle size. Smaller steel abrasive particles will produce the same impact value as nonmetallic particles 1-1/2 to 2 1/2 times larger. With the smaller steel abrasive there are more abrasive particles impacting the surface per unit time, which means faster cleaning rates. Particle Size : Abrasive particle size influences two primary functions of blast cleaning, rate of cleaning and profile. Decreasing particle size may increase cleaning rate because more particles are impacting the surface per unit time. Increasing abrasive size may be necessary to increase profile and/ or to remove heavy coatings.Particle Hardness : It is generally believed that the harder an abrasive, the better it will perform on difficult to clean areas.Dust Generation: Metallic abrasives do not break down on impact like conventional nonmetallic abrasive product's. Consequently, there is considerably less dust and waste generated during the blasting process. Low dust levels mean better visibility, faster cleaning, increased productivity and shorter cleanups, saving time and labor and disposal costs
Supplier : Abradant International LLC DUBAI
Posted On :2 years ago


We are Manufacturer for ALLOY STEEL P11 grade Butt weld Fitting: -   Size:  -1/2” to 24” Schedules: -Sch 5, Sch 10, Sch 20, Sch 30, Sch 40, Sch STD, Sch 80, Sch XS, Sch 60, Sch 100, Sch 120, Sch 140, Sch 160, Sch XXS. Type: - SEAMLESS, WELDED. Description: -90Deg Elbow, 45Deg Elbow, Concentric Reducer, Eccentric Reducer, Cap, Tee, Reducing Tee, Unequal Tee.   Other standards:  - Alloy Steel chrome moly type 1.1/4Cr-1/2Mo ASTM /ASME A234 WP11 Din Standard  13CRM044 UNS K11572  Casting A217-WC6 Din W.No 1.7335   We also supply Flanges, Forged Fitting, Round bar, Outlets, Plate and Pipe.
Supplier : Gautam Steel Private Limited MUMBAI
Posted On :2 years ago


Supplier : Al Saqr Industries LLC SHARJAH
Posted On :2 years ago


Posted On :2 years ago


Raman+971 567440635Ayanchem FZE
Posted On :2 years ago

Modular Crimping Tool suppliers in Dubai

Infilink-Modular Crimping Tool for 8P8C/6P6C/6P4C
Supplier : Synergix International LLC DUBAI
Posted On :2 years ago


Posted On :2 years ago

Window Cleaning Equipment Suppliers In UAE

Daitona General Trading L.L.C. is one of the UAE’s leading general cleaning items and janitorial equipment supply companies. Ahmadaly Fazal, Managing Director and CEO, traces the company’s journey over the years. For any specialized professional organization, quality, training, service and competitiveness are a sure recipe for success - more so in an economy like Dubai. Daitona General Trading L.L.C. was set up in Dubai by Ahmadaly Fazal, the Managing Director and CEO, just before the Gulf War in 1991. He was following in the footsteps of his father, Late Habib Fazal who had sold his 2-year old cleaning items business in 1984 to migrate to Canada. In 2010, Ahmadaly Fazal was joined by his uncle and now Partner, Nizar Karmali, who is well-known in the institutional business. Today, Daitona General Trading L.L.C. employs 20 people who regularly undergo training in different subjects to keep them abreast with the industry. With his training background in a leading international organization, Karmali spends some of his time preparing course materials for training the Daitona team. Stocks, logistics and showroom: With all orders being required by ‘yesterday’, having ample stocks is crucial for offering prompt deliveries. Daitona carries a large inventory in its four warehouses in Sharjah and one in Dubai. More vehicles have been added to cope with the business growth and demands of the customers. With three pickup trucks and one van, the company smoothly handles all deliveries within UAE. Daitona took its first warehouse in Al Khabaisi area, Deira. The office was also within the warehouse. A year later, a display area was dedicated within the warehouse office. With the growth of the company in 2004 to 2006, Daitona acquired a full-fledged showroom cum office in Abu Hail, Deira. This was the first of its kind in the UAE, then. Today, Daitona is a one stop shop for all the cleaning and janitorial needs of its customers.   The future: The aim of Daitona General Trading L.L.C. is to continue being a leading supplier of quality and durable cleaning and janitorial equipment and accessories with focus on customer service. From a company starting off with air fresheners to one that sells all possible quality cleaning products (with the exception of heavy machines), Daitona General Trading L.L.C. has certainly come a long way.   The brands Daitona represent are: Hygiene System, Vita, IPC Ready System Italy, IPC Pulex Italy, Mr. Brush, KSI, Coronet, Aricasa, Celtex, Papernet, AZ Hygiene, Scentpur, Nu Fresh, Fragmatic, HS Chemicals, Cavallo, Baiyun Cleaning, etc... Under the above-mentioned brands we have the following products… Household Cleaning Products, House Keeping Cleaning Products, Cleaning equipment, Hotel Supplies, Hygiene Systems Cleaning Products, Daitona Cleaning Products, IPC Cleaning Products, Pulex Cleaning Products, Vita Cleaning Products, Mr. Brush Cleaning Products, Celtex Tissue Paper Products, Papernet Tissue Paper Products, Coronet Cleaning Products, Kach Sheng Cleaning Products, Baiyun Cleaning Products, Cavallo Cleaning Products, AZ Hygiene Product, Cleaning Equipment, Aricasa Cleaning Products, Scentpur Products, General Cleaning Products, Floor Cleaning Products, Window Cleaning Products, Janitorial equipment, Wash Room Cleaning Products, Kitchen Cleaning Products, Medical Rolls, Hand Towel Rolls, Center Feed Rolls, Maxi Rolls, Toilet Tissue Rolls, Jumbo Rolls, Toilet Rolls, C-fold Paper, V-Fold Paper, Z-Fold Paper, Interfold, Toilet Tissue Paper, Soft Brooms and Brushes, Hard Brooms and Brushes, Street Brooms,Coco Brooms, Dustpan Sets and Brushes, Vita Mops And Wipers, Floor Squeegees, Window Squeegees, Window Applicators, Aluminum handles, Mop Handles, Metal Handles, Mop Clips, Kentucky Mops, Dustpan and Brooms, Dust Bins, Steel Bins, Plastics Bins, Sanibins, Dry Mops, Wet Mops, Round Mops, Metal Clip Mops, Plastics Clip Mop, Door Mats, Urinal Blocks, Channel Blocks, Hand Soap Liquid, Antibacterial Hand Soap Liquid, Antiseptic Liquid, Foam Soap, All Purpose Cleaner, Pine Disinfectant, Antiseptic Disinfectant, Bleach Liquid, Glass Cleaning Liquid, Dishwashing Liquid, Rubber Gloves, Automatic Hand Dryers, Microfiber Mops, Microfiber Cloths, Housekeeping Trolleys, Janitorial Trolleys, Single Mop Buckets Trolleys, Double Mop Buckets, Mop Wringers, Litter Picker, Kitchen Towels, Paper Dispensers, Multi Fold Dispensers, Soap Dispensers, Aerosol Fragrance Dispensers, Aerosol Fragrance, Stainless Steel Bins, Plastic Garbage Bins, Waste Bins, HS Chemicals Products, Wet Floor Sign Board, Floor Scrubbing Pads, Automatic Aerosol Dispensers, Auto Soap Dispensers, Auto Foam Dispensers, Hand Sanitizer Dispensers, JRT Dispensers, Sponge Combo, Steel Wool, Scrubbing Pad, PP Duster, etc..... Tel-04-297-7972 & 04-268-3390 Email-info@daitona.com www.daitona.com
Posted On :2 years ago


White Metal Contracting llc has always endeavoured to innovative and supports its clients to perform better, by meeting their demand for quality, service, competitiveness and timely completion of specified scope of work. Continuously achieve and improve the effectiveness of the works and systematic developments in the organization.White Metal Contracting llc is considered as one of the few specialist companies for supply and installation of industrial works, with proven experience in the UAE Construction projects.Email : sales@whitemetalco.comPlease visit our site : www.whitemetalco.com
Supplier : White Metal Contracting LLC AJMAN
Posted On :2 years ago

CHICKEN GRILL MACHINE شواية دجاج ماكينة

We Are Dealing All Type Of  Kitchen And Restaurant Equipments Spare Parts.Chicken Grill Machine and Spare Parts. for Inquiry Send Us Email On Sales@viaemex.com Or Contact Us.Tel: 06-5444118 Mobile: 050-7876364 ...
Supplier : Viaemex SHARJAH
Posted On :2 years ago


This line can be a single, double, triple and quartet output to satisfy any customer's need concerning both production capacity and size. It can produce a range between 500 up to 1200 loafs per hour with a diameter between 15 to 40cm.
Posted On :2 years ago

Cotton Rugs

Cotton Rugs Available in UAECotton Rugs Available in DubaiCotton Rugs Supplier in UAECotton Rugs Supplier in Dubai
Supplier : MINCORP Trading LLC DUBAI
Posted On :2 years ago


These cabinets are available in either single door or double doors. Ideally, a single door weatherproof surface mounted Fire Hose Reel Cabinet is best suited to fixed and swinging hose reels – with an easy three step, one man installation. A free standing external cabinet is designed to mount on legs where the hose reel is sited away from a wall or support structure.Flush/recessed mounting cabinets complete with architrave surround frame, are used primarily in cavity/brick walls where a cover is required. A simple door and surround cabinet can be fixed to an opening, where a hose reel is built into the building. 
Posted On :2 years ago

Wash Basin Tap Grohe Supplier in UAE

Wash Basin Tap Grohe in UAE
Supplier : Spark Technical Supplies FZE SHARJAH
Posted On :2 years ago


Supplier : Yashtech Services FZC SHARJAH
Posted On :2 years ago

Corrugated Roofing Sheet Oman

Pre Painted Galvanized Corrugated & Profile Roof Sheet Supplier in UAE OmanGhosh Metal Industries – Metal roofing profile is also named steel roof sheet, raw material is pre-painted hot dipped galvanized steel sheet, used as popular structural metal roofing materials and pre-painted aluminium coil sheet.Thickness: 0.30 mm to 0.90 mmStandard Width after corrugation: 1000 mmLength: Subject to customer choiceWith RAL Color of any as customer choice like RAL 9002 – Off White, RAL 1001 Beige, RAL 5012 Light Blue, RAL 5010 Dark Blue, RAL 5002 EMMAR Blue, RAL 7046 Dark Grey, RAL 7036 Grey, RAL 7037 Grey, RAL 1014 light beige, RAL 1015 Ivory, RAL 9003 White, RAL 9010 Pure White, RAL 3002 RED, RAL 3020 RED, RAL 2004 Orange, RAL 7015 Grey, RAL 6038 Green, RAL 6029 Light Green, and more.Ghosh Metal offerings high grade trapezoidal cladding sheets, which are widely installed for their attractive designs and robustness in buildings.These are built using high grade metals, such as stainless steel, copper, aluminum, zinc, bronze and titanium. The sheets come with accurate dimensions and are easy to installProfile design we have following cover width: – 35/200 mm – 45/250 mm x 1000 mm – 45/150 mm x 900 mmThe Advantage of Metal and Aluminium Roof Sheet: (1) Easy installation (2) High strength (3) Low in costs (4) Durable (5) Nice appearanceBelow is the required accessorises for the roof profile and sandwich panel sheet for shed and ware-house, industrial roof as top ridge, bottom ridge, rain gutter, vally gutter, and flashing corner.GHOSH METAL – has new corrugation line in UAE for S Type / waves type corrugation (Galvanized Corrugated) sheet with 16 to 20 mm. Waves and pitch waves distance 75 to 76 mm with cover width after corrugation 780 mm 900 mm 1000 mm x Length we can cut subject to our customer choice.Thickness: 0.28 mm (Gauge32 to Gauge20) to 0.90 mmGalvanized Steel of Ghosh Meal Dubai Ajman United Arab Emirates factory. .fusion-button.button-1 .fusion-button-text, .fusion-button.button-1 i {color:#fcfcfc;}.fusion-button.button-1 {border-width:0px;border-color:#fcfcfc;}.fusion-button.button-1 .fusion-button-icon-divider{border-color:#fcfcfc;}.fusion-button.button-1:hover .fusion-button-text, .fusion-button.button-1:hover i,.fusion-button.button-1:focus .fusion-button-text, .fusion-button.button-1:focus i,.fusion-button.button-1:active .fusion-button-text, .fusion-button.button-1:active{color:#ffffff;}.fusion-button.button-1:hover, .fusion-button.button-1:focus, .fusion-button.button-1:active{border-width:0px;border-color:#ffffff;}.fusion-button.button-1:hover .fusion-button-icon-divider, .fusion-button.button-1:hover .fusion-button-icon-divider, .fusion-button.button-1:active .fusion-button-icon-divider{border-color:#ffffff;}.fusion-button.button-1{background: #138ccc;}.fusion-button.button-1:hover,.button-1:focus,.fusion-button.button-1:active{background: #1a80b6;}.fusion-button.button-1{width:auto;} ENQUIRE FILL THE FORM or .fusion-button.button-2 .fusion-button-text, .fusion-button.button-2 i {color:#fcfcfc;}.fusion-button.button-2 {border-width:0px;border-color:#fcfcfc;}.fusion-button.button-2 .fusion-button-icon-divider{border-color:#fcfcfc;}.fusion-button.button-2:hover .fusion-button-text, .fusion-button.button-2:hover i,.fusion-button.button-2:focus .fusion-button-text, .fusion-button.button-2:focus i,.fusion-button.button-2:active .fusion-button-text, .fusion-button.button-2:active{color:#ffffff;}.fusion-button.button-2:hover, .fusion-button.button-2:focus, .fusion-button.button-2:active{border-width:0px;border-color:#ffffff;}.fusion-button.button-2:hover .fusion-button-icon-divider, .fusion-button.button-2:hover .fusion-button-icon-divider, .fusion-button.button-2:active .fusion-button-icon-divider{border-color:#ffffff;}.fusion-button.button-2{background: #138ccc;}.fusion-button.button-2:hover,.button-2:focus,.fusion-button.button-2:active{background: #1a80b6;}.fusion-button.button-2{width:auto;} CALL US (works on mobile or calling device)For enquiry and sales, please email us on parimal@ghoshgroups.com or call +971 553 258 409If you are on smartphone, press the nos to call directly
Posted On :2 years ago


Group 0 Displacements from 0.16 cm3/revolution to 2.28 cm3/revolution. Maximum pressures up to 280 bar.Group 1 Displacements from 0.91 cm3/revolution to 9.88 cm3/revolution. Maximum pressures up to 300 bar.Group 2 Displacements from 4.2 cm3/revolution to 39.6 cm3/revolution. Maximum pressures up to 300 bar.Group 3 Displacements from 14.89 cm3/revolution to 86.87 cm3/revolution. Maximum pressures up to 320 bar.
Posted On :2 years ago


BUTTWELDING MACHINE DEALERS IN SHARJAHWe have electro fusion Couplers ranging from 20mm to 630mm
Posted On :2 years ago

Bend Pipes

A pipe bending machine is vital component for any pipe bending project, particularly those of a large scale. A pipe bending machine makes the job easier and is capable of completing multiple jobs in less time than when working by hand. A pipe bending machine can be either handheld or floor mounted. In either case, the pipe bending machine allows the user to hold the pipe at one end of the channel while the shape roller forces the pipe through and carries it around in a curve. A pipe bending machine can be purchased with a variety of pipe bending capabilities. Material: A234-WPB A234-WP12 A234-WP11 A234-WP5 A403-WP304 A403-WP304L A403-WP316. A403-WP316L A420-WPL6, Ceramic LinedSpecial alloys: cooper nickel, Ni-based, Cu-based, Co-based, Fe-basedSize: Outer Diameter (D): D<=1220mm / Wall Thickness (T): T<=120mmPressure: SCH5 to SCH160Manufacturing standard: ANSI, JIS, DIN, EN, API 5L, etc.Bending Radius(R): 3D, 4D, 5D, 6D, 7D, 8D, 9D, 10DBending Angle: Degree 15, 30, 45, 60, 90, 135, 180 and also could manufacture according the angles given by the clients.Straight Length (L): The length between two ends general from 300mm-1500mm, and also can product according to the clients' requiry.End Bevel: According to the bevel of welding pipe fittings constructionPacking: Plywood Case/ Pallet/ other
Posted On :2 years ago

Anatomical Model of Heart (Dubai UAE)

This life size, two-part model comes complete with a stand. The parts separate to show internal structures of the ventricle and atrium, including valves. The roots of the vessels can also be seen.Dimensions: 12 x 12 x 22cm.
Supplier : Arasca Medical Equipment Trading LLC DUBAI
Posted On :2 years ago


Supplier : Uruguay Group of Companies ABU DHABI
Posted On :3 years ago


Measuring Tools Finishing Tools Striking & Struck Tools Layout Tools Fastening Tools Storage Cutting Tools Laser Tools & Stud Sensors Automotive Tools Clamps & Vises Flashlights Woodworking Paint Preparation American Heritage High Visibility HVAC Tools
Supplier : Royal City Electrical Appliances LLC ABU DHABI
Posted On :3 years ago


GI PLAIN SHEET 4' X 8' X 0.40 MM GI PLAIN SHEET 4' X 8' X 0.56 MM GI PLAIN SHEET 4' X 8' X 0.70 MM GI PLAIN SHEET 4' X 8' X 0.90 MM GI PLAIN SHEET 4' X 8' X 1.20 MM GI PLAIN SHEET 4' X 8' X 1.50 MM GI PLAIN SHEET 4' X 8' X 2.00 MM GI PLAIN SHEET 4' X 8' X 2.50 MM GI PLAIN SHEET 4' X 8' X 3.00 MM GI PLAIN SHEET 4' X 8' X 4.00 MM
Posted On :3 years ago


Posted On :3 years ago

Clear Tape

Clear tape 2"
Posted On :3 years ago


We are manufacturers & exporters of eye bolt in grade UNS 31803, UNS 32750, UNS32760, INCONEL, MONEL,TITANIUM, HASTELLOY, 304, 304L. 316. 316L. 317L. 316LN, 310S, 321, 321H, 347, 347H, 904L, HIGH TENSILE etc.For more details you can contact us freely at jainexmetal@gmail.com
Supplier : Jainex Metal Industries MUMBAI
Posted On :3 years ago

Wagner SF23 Plus Concrete Injection & Epoxy Spray

The powerful diaphragm airless spray pumps are robust, yet lightweight construction site and workshop units. Equipped with the new QLS technology they can apply a wide range of materials from paints and emulsions up to high viscosity materials, depending on the airless spray unit.Airless spray function allows the opportunity to work in the following aspect with the following equipment and materials :Painting Equipment, coating equipment, airless spray, spray paint, paint application, epoxy application, Hi- built paint, Air assist spray, Air coating spray, air coating, steel coating, heavy coat, high viscosity paint, intumiscent paint, flame retardant, anti corrosion paint, bituminous coating, Thick paint, thick coating, spray pack, airless spray paint, spray paint, airless spray.Contact Us:http://bit.ly/1icCd6Q
Supplier : OTAL L.L.C DUBAI
Posted On :3 years ago


Garnet is using for Sand blastingDifferent sizes of garnet 30/60,20/40,12/20,80 mesh,120 mesh
Supplier : Powerblast llc Umm Al Quwain
Posted On :3 years ago

Abrasive belt Supplier Dubai UAE

Posted On :3 years ago